Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relB-yefM/YoeB-RelB
Location 713050..713566 Replicon chromosome
Accession NZ_CP114195
Organism Vibrio parahaemolyticus strain vp-HL-202005

Toxin (Protein)


Gene name relB Uniprot ID -
Locus tag O1Q84_RS20415 Protein ID WP_029865924.1
Coordinates 713050..713319 (-) Length 90 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID -
Locus tag O1Q84_RS20420 Protein ID WP_029865959.1
Coordinates 713312..713566 (-) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O1Q84_RS20375 (O1Q84_20375) 708180..708545 + 366 WP_031428075.1 hypothetical protein -
O1Q84_RS20380 (O1Q84_20380) 708889..709827 - 939 WP_031428077.1 DMT family transporter -
O1Q84_RS20385 (O1Q84_20385) 709931..710812 + 882 WP_108653693.1 LysR family transcriptional regulator -
O1Q84_RS20390 (O1Q84_20390) 711016..711504 - 489 WP_108653692.1 DUF523 domain-containing protein -
O1Q84_RS20395 (O1Q84_20395) 711622..712128 - 507 WP_229607483.1 ClbS/DfsB family four-helix bundle protein -
O1Q84_RS20400 (O1Q84_20400) 712226..712294 - 69 WP_080254664.1 DUF3265 domain-containing protein -
O1Q84_RS20405 (O1Q84_20405) 712369..712617 + 249 WP_025611568.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
O1Q84_RS20410 (O1Q84_20410) 712607..712897 + 291 WP_108653690.1 type II toxin-antitoxin system RelE/ParE family toxin -
O1Q84_RS20415 (O1Q84_20415) 713050..713319 - 270 WP_029865924.1 Txe/YoeB family addiction module toxin Toxin
O1Q84_RS20420 (O1Q84_20420) 713312..713566 - 255 WP_029865959.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
O1Q84_RS20425 (O1Q84_20425) 713668..713760 - 93 WP_140321407.1 DUF3265 domain-containing protein -
O1Q84_RS20430 (O1Q84_20430) 713875..714843 + 969 WP_159404068.1 IS30-like element ISVa6 family transposase -
O1Q84_RS20435 (O1Q84_20435) 715387..716379 - 993 WP_108654759.1 hypothetical protein -
O1Q84_RS20440 (O1Q84_20440) 717093..718163 + 1071 WP_108653902.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 677362..724386 47024
- flank IS/Tn - - 714067..714843 776


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(10-89)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10628.98 Da        Isoelectric Point: 7.9816

>T266418 WP_029865924.1 NZ_CP114195:c713319-713050 [Vibrio parahaemolyticus]
MSSSQRLLSWTDDAWDDYLYWQTQDKKTLKRINKLINDVKRSPFEGIGKPEPLKENLSGFWSRRVDDTNRLVYAVDDQVI
TIISCRYHY

Download         Length: 270 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9467.63 Da        Isoelectric Point: 5.0623

>AT266418 WP_029865959.1 NZ_CP114195:c713566-713312 [Vibrio parahaemolyticus]
MRIVSFTEARNALKAVLDGVVNDADTTVITRRDSEDAVVMSLDYYNSLMETVHLLRSPQNAEHLNRSIAQYRAGKTTARE
LIDE

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References