Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 712369..712897 | Replicon | chromosome |
| Accession | NZ_CP114195 | ||
| Organism | Vibrio parahaemolyticus strain vp-HL-202005 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | O1Q84_RS20410 | Protein ID | WP_108653690.1 |
| Coordinates | 712607..712897 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | O1Q84_RS20405 | Protein ID | WP_025611568.1 |
| Coordinates | 712369..712617 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O1Q84_RS20375 (O1Q84_20375) | 708180..708545 | + | 366 | WP_031428075.1 | hypothetical protein | - |
| O1Q84_RS20380 (O1Q84_20380) | 708889..709827 | - | 939 | WP_031428077.1 | DMT family transporter | - |
| O1Q84_RS20385 (O1Q84_20385) | 709931..710812 | + | 882 | WP_108653693.1 | LysR family transcriptional regulator | - |
| O1Q84_RS20390 (O1Q84_20390) | 711016..711504 | - | 489 | WP_108653692.1 | DUF523 domain-containing protein | - |
| O1Q84_RS20395 (O1Q84_20395) | 711622..712128 | - | 507 | WP_229607483.1 | ClbS/DfsB family four-helix bundle protein | - |
| O1Q84_RS20400 (O1Q84_20400) | 712226..712294 | - | 69 | WP_080254664.1 | DUF3265 domain-containing protein | - |
| O1Q84_RS20405 (O1Q84_20405) | 712369..712617 | + | 249 | WP_025611568.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| O1Q84_RS20410 (O1Q84_20410) | 712607..712897 | + | 291 | WP_108653690.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| O1Q84_RS20415 (O1Q84_20415) | 713050..713319 | - | 270 | WP_029865924.1 | Txe/YoeB family addiction module toxin | - |
| O1Q84_RS20420 (O1Q84_20420) | 713312..713566 | - | 255 | WP_029865959.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
| O1Q84_RS20425 (O1Q84_20425) | 713668..713760 | - | 93 | WP_140321407.1 | DUF3265 domain-containing protein | - |
| O1Q84_RS20430 (O1Q84_20430) | 713875..714843 | + | 969 | WP_159404068.1 | IS30-like element ISVa6 family transposase | - |
| O1Q84_RS20435 (O1Q84_20435) | 715387..716379 | - | 993 | WP_108654759.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 677362..724386 | 47024 | |
| - | flank | IS/Tn | - | - | 714067..714843 | 776 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11300.24 Da Isoelectric Point: 10.5339
>T266417 WP_108653690.1 NZ_CP114195:712607-712897 [Vibrio parahaemolyticus]
MTYRLDFKKSALKEWKKLGSTLQQQFKKKLIDRLDNPHVPASKLSGTDNMYKIKLRQSGYRLVYKVEDDVIIVTILAVGK
HERSDVYRKAMKRLDD
MTYRLDFKKSALKEWKKLGSTLQQQFKKKLIDRLDNPHVPASKLSGTDNMYKIKLRQSGYRLVYKVEDDVIIVTILAVGK
HERSDVYRKAMKRLDD
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|