Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
| Location | 2051518..2052065 | Replicon | chromosome |
| Accession | NZ_CP114194 | ||
| Organism | Vibrio parahaemolyticus strain vp-HL-202005 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A7Y0S5Y1 |
| Locus tag | O1Q84_RS09965 | Protein ID | WP_025796191.1 |
| Coordinates | 2051518..2051820 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | U3A269 |
| Locus tag | O1Q84_RS09970 | Protein ID | WP_005448240.1 |
| Coordinates | 2051808..2052065 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O1Q84_RS09925 (O1Q84_09925) | 2046579..2047025 | - | 447 | WP_069536379.1 | GNAT family N-acetyltransferase | - |
| O1Q84_RS09930 (O1Q84_09930) | 2047161..2048186 | - | 1026 | WP_069536378.1 | AbiV family abortive infection protein | - |
| O1Q84_RS09935 (O1Q84_09935) | 2048213..2048302 | - | 90 | WP_079740859.1 | DUF3265 domain-containing protein | - |
| O1Q84_RS09940 (O1Q84_09940) | 2048941..2049495 | - | 555 | WP_069536190.1 | hypothetical protein | - |
| O1Q84_RS09945 (O1Q84_09945) | 2049518..2049610 | - | 93 | WP_079879160.1 | DUF3265 domain-containing protein | - |
| O1Q84_RS09950 (O1Q84_09950) | 2050174..2050818 | - | 645 | WP_025506675.1 | hypothetical protein | - |
| O1Q84_RS09955 (O1Q84_09955) | 2050846..2050953 | - | 108 | Protein_1936 | DUF3265 domain-containing protein | - |
| O1Q84_RS09960 (O1Q84_09960) | 2051390..2051482 | - | 93 | WP_079879159.1 | DUF3265 domain-containing protein | - |
| O1Q84_RS09965 (O1Q84_09965) | 2051518..2051820 | - | 303 | WP_025796191.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| O1Q84_RS09970 (O1Q84_09970) | 2051808..2052065 | - | 258 | WP_005448240.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| O1Q84_RS09975 (O1Q84_09975) | 2052630..2052722 | - | 93 | WP_072600976.1 | DUF3265 domain-containing protein | - |
| O1Q84_RS09980 (O1Q84_09980) | 2052789..2053001 | - | 213 | WP_029858137.1 | hypothetical protein | - |
| O1Q84_RS09985 (O1Q84_09985) | 2053174..2053266 | - | 93 | WP_079879201.1 | DUF3265 domain-containing protein | - |
| O1Q84_RS09990 (O1Q84_09990) | 2053281..2053868 | - | 588 | WP_267391652.1 | hypothetical protein | - |
| O1Q84_RS09995 (O1Q84_09995) | 2053903..2054394 | - | 492 | WP_267391651.1 | DUF4236 domain-containing protein | - |
| O1Q84_RS10000 (O1Q84_10000) | 2054560..2054895 | - | 336 | WP_069536414.1 | hypothetical protein | - |
| O1Q84_RS10005 (O1Q84_10005) | 2054922..2055014 | - | 93 | WP_011105940.1 | DUF3265 domain-containing protein | - |
| O1Q84_RS10010 (O1Q84_10010) | 2055485..2056117 | - | 633 | WP_069536413.1 | DUF2971 domain-containing protein | - |
| O1Q84_RS10015 (O1Q84_10015) | 2056148..2056240 | - | 93 | WP_079750688.1 | DUF3265 domain-containing protein | - |
| O1Q84_RS10020 (O1Q84_10020) | 2056230..2056997 | - | 768 | WP_069536412.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | qnrVC6 | - | 1942102..2120450 | 178348 | |
| - | inside | Integron | - | - | 2031180..2119315 | 88135 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11655.54 Da Isoelectric Point: 5.1765
>T266416 WP_025796191.1 NZ_CP114194:c2051820-2051518 [Vibrio parahaemolyticus]
MAEVIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPELEHLSYREVVVNPCRVFYKQDGDKV
FILFVMRAERDLRKFLLSKQ
MAEVIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPELEHLSYREVVVNPCRVFYKQDGDKV
FILFVMRAERDLRKFLLSKQ
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7Y0S5Y1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A432DGX8 |