Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/Phd(antitoxin)
Location 2051518..2052065 Replicon chromosome
Accession NZ_CP114194
Organism Vibrio parahaemolyticus strain vp-HL-202005

Toxin (Protein)


Gene name relE Uniprot ID A0A7Y0S5Y1
Locus tag O1Q84_RS09965 Protein ID WP_025796191.1
Coordinates 2051518..2051820 (-) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID U3A269
Locus tag O1Q84_RS09970 Protein ID WP_005448240.1
Coordinates 2051808..2052065 (-) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O1Q84_RS09925 (O1Q84_09925) 2046579..2047025 - 447 WP_069536379.1 GNAT family N-acetyltransferase -
O1Q84_RS09930 (O1Q84_09930) 2047161..2048186 - 1026 WP_069536378.1 AbiV family abortive infection protein -
O1Q84_RS09935 (O1Q84_09935) 2048213..2048302 - 90 WP_079740859.1 DUF3265 domain-containing protein -
O1Q84_RS09940 (O1Q84_09940) 2048941..2049495 - 555 WP_069536190.1 hypothetical protein -
O1Q84_RS09945 (O1Q84_09945) 2049518..2049610 - 93 WP_079879160.1 DUF3265 domain-containing protein -
O1Q84_RS09950 (O1Q84_09950) 2050174..2050818 - 645 WP_025506675.1 hypothetical protein -
O1Q84_RS09955 (O1Q84_09955) 2050846..2050953 - 108 Protein_1936 DUF3265 domain-containing protein -
O1Q84_RS09960 (O1Q84_09960) 2051390..2051482 - 93 WP_079879159.1 DUF3265 domain-containing protein -
O1Q84_RS09965 (O1Q84_09965) 2051518..2051820 - 303 WP_025796191.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
O1Q84_RS09970 (O1Q84_09970) 2051808..2052065 - 258 WP_005448240.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
O1Q84_RS09975 (O1Q84_09975) 2052630..2052722 - 93 WP_072600976.1 DUF3265 domain-containing protein -
O1Q84_RS09980 (O1Q84_09980) 2052789..2053001 - 213 WP_029858137.1 hypothetical protein -
O1Q84_RS09985 (O1Q84_09985) 2053174..2053266 - 93 WP_079879201.1 DUF3265 domain-containing protein -
O1Q84_RS09990 (O1Q84_09990) 2053281..2053868 - 588 WP_267391652.1 hypothetical protein -
O1Q84_RS09995 (O1Q84_09995) 2053903..2054394 - 492 WP_267391651.1 DUF4236 domain-containing protein -
O1Q84_RS10000 (O1Q84_10000) 2054560..2054895 - 336 WP_069536414.1 hypothetical protein -
O1Q84_RS10005 (O1Q84_10005) 2054922..2055014 - 93 WP_011105940.1 DUF3265 domain-containing protein -
O1Q84_RS10010 (O1Q84_10010) 2055485..2056117 - 633 WP_069536413.1 DUF2971 domain-containing protein -
O1Q84_RS10015 (O1Q84_10015) 2056148..2056240 - 93 WP_079750688.1 DUF3265 domain-containing protein -
O1Q84_RS10020 (O1Q84_10020) 2056230..2056997 - 768 WP_069536412.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island qnrVC6 - 1942102..2120450 178348
- inside Integron - - 2031180..2119315 88135


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-69)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11655.54 Da        Isoelectric Point: 5.1765

>T266416 WP_025796191.1 NZ_CP114194:c2051820-2051518 [Vibrio parahaemolyticus]
MAEVIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPELEHLSYREVVVNPCRVFYKQDGDKV
FILFVMRAERDLRKFLLSKQ

Download         Length: 303 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9606.10 Da        Isoelectric Point: 6.7269

>AT266416 WP_005448240.1 NZ_CP114194:c2052065-2051808 [Vibrio parahaemolyticus]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLVDVDDYEFMQNRLAILEGIARGERALADGKVVSHDEAKDKM
SKWLK

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7Y0S5Y1

Antitoxin

Source ID Structure
AlphaFold DB A0A432DGX8

References