Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 4274795..4275375 | Replicon | chromosome |
| Accession | NZ_CP114190 | ||
| Organism | Aminobacter sp. NyZ550 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | N7E70_RS21170 | Protein ID | WP_182573711.1 |
| Coordinates | 4274795..4275085 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | N7E70_RS21175 | Protein ID | WP_182573637.1 |
| Coordinates | 4275082..4275375 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7E70_RS21145 (N7E70_021150) | 4270309..4270641 | - | 333 | WP_067966794.1 | hypothetical protein | - |
| N7E70_RS21150 (N7E70_021155) | 4270695..4272365 | - | 1671 | WP_263007521.1 | portal protein | - |
| N7E70_RS21155 (N7E70_021160) | 4272365..4272577 | - | 213 | WP_067963548.1 | hypothetical protein | - |
| N7E70_RS21160 (N7E70_021165) | 4272574..4274148 | - | 1575 | WP_263007522.1 | terminase family protein | - |
| N7E70_RS21165 (N7E70_021170) | 4274135..4274635 | - | 501 | WP_263007523.1 | DNA-packaging protein | - |
| N7E70_RS21170 (N7E70_021175) | 4274795..4275085 | + | 291 | WP_182573711.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N7E70_RS21175 (N7E70_021180) | 4275082..4275375 | + | 294 | WP_182573637.1 | putative addiction module antidote protein | Antitoxin |
| N7E70_RS21180 (N7E70_021185) | 4275516..4275740 | - | 225 | WP_182573636.1 | hypothetical protein | - |
| N7E70_RS21185 (N7E70_021190) | 4276580..4276921 | + | 342 | WP_263007524.1 | hypothetical protein | - |
| N7E70_RS21190 (N7E70_021195) | 4277174..4277320 | - | 147 | WP_263007525.1 | hypothetical protein | - |
| N7E70_RS21195 (N7E70_021200) | 4277496..4277606 | + | 111 | Protein_4185 | MarR family transcriptional regulator | - |
| N7E70_RS21200 (N7E70_021205) | 4277658..4278437 | - | 780 | WP_263007526.1 | SDR family oxidoreductase | - |
| N7E70_RS21205 (N7E70_021210) | 4278434..4278757 | - | 324 | WP_263007527.1 | nuclear transport factor 2 family protein | - |
| N7E70_RS21210 (N7E70_021215) | 4278859..4279773 | + | 915 | WP_263007528.1 | LysR family transcriptional regulator | - |
| N7E70_RS21215 (N7E70_021220) | 4279959..4280354 | - | 396 | WP_263007529.1 | AraC family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | htpB | 4241455..4294175 | 52720 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10677.37 Da Isoelectric Point: 10.0988
>T266413 WP_182573711.1 NZ_CP114190:4274795-4275085 [Aminobacter sp. NyZ550]
VIEIRRTAEFTGWLTDLKDLKARSRILTRIDRLELGNSGDAKYFDGIGELRVDTGPGYRVYFVKRGTTVVILLCGGDKST
QASDIKKAIAMAKEVK
VIEIRRTAEFTGWLTDLKDLKARSRILTRIDRLELGNSGDAKYFDGIGELRVDTGPGYRVYFVKRGTTVVILLCGGDKST
QASDIKKAIAMAKEVK
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|