Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 1528312..1528840 Replicon chromosome
Accession NZ_CP114186
Organism Vibrio parahaemolyticus strain PH1273

Toxin (Protein)


Gene name relE Uniprot ID K5TRR0
Locus tag O2T11_RS07545 Protein ID WP_005377002.1
Coordinates 1528312..1528602 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A347UR02
Locus tag O2T11_RS07550 Protein ID WP_005377003.1
Coordinates 1528592..1528840 (-) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O2T11_RS07500 (O2T11_07500) 1523843..1523947 + 105 WP_229616293.1 DUF3265 domain-containing protein -
O2T11_RS07505 (O2T11_07505) 1524351..1524494 + 144 WP_072611506.1 DUF3265 domain-containing protein -
O2T11_RS07510 (O2T11_07510) 1524528..1525004 + 477 WP_064490384.1 GNAT family N-acetyltransferase -
O2T11_RS07515 (O2T11_07515) 1524967..1525110 + 144 WP_031857379.1 DUF3265 domain-containing protein -
O2T11_RS07520 (O2T11_07520) 1525142..1525861 + 720 WP_031857378.1 hypothetical protein -
O2T11_RS07525 (O2T11_07525) 1525876..1525968 + 93 WP_237769889.1 DUF3265 domain-containing protein -
O2T11_RS07530 (O2T11_07530) 1526387..1526516 + 130 Protein_1455 DUF3265 domain-containing protein -
O2T11_RS07535 (O2T11_07535) 1527552..1527683 + 132 WP_078235875.1 DUF3265 domain-containing protein -
O2T11_RS07540 (O2T11_07540) 1528204..1528293 + 90 WP_077680412.1 DUF3265 domain-containing protein -
O2T11_RS07545 (O2T11_07545) 1528312..1528602 - 291 WP_005377002.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
O2T11_RS07550 (O2T11_07550) 1528592..1528840 - 249 WP_005377003.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
O2T11_RS07555 (O2T11_07555) 1528915..1528983 + 69 WP_074531725.1 DUF3265 domain-containing protein -
O2T11_RS07560 (O2T11_07560) 1529130..1529348 + 219 WP_021485178.1 DUF6500 family protein -
O2T11_RS07565 (O2T11_07565) 1529536..1529778 + 243 WP_050550698.1 hypothetical protein -
O2T11_RS07570 (O2T11_07570) 1530280..1530369 + 90 WP_072828858.1 DUF3265 domain-containing protein -
O2T11_RS07575 (O2T11_07575) 1530427..1530804 + 378 WP_020838894.1 hypothetical protein -
O2T11_RS07580 (O2T11_07580) 1530830..1530919 + 90 WP_078235888.1 DUF3265 domain-containing protein -
O2T11_RS07585 (O2T11_07585) 1531038..1531379 + 342 WP_229032666.1 RDD family protein -
O2T11_RS07590 (O2T11_07590) 1531346..1531432 + 87 Protein_1467 DUF3265 domain-containing protein -
O2T11_RS07595 (O2T11_07595) 1531512..1531949 + 438 WP_140079566.1 GIY-YIG nuclease family protein -
O2T11_RS07600 (O2T11_07600) 1532088..1532486 + 399 WP_031857246.1 SMI1/KNR4 family protein -
O2T11_RS07605 (O2T11_07605) 1532970..1533062 + 93 WP_004402681.1 DUF3265 domain-containing protein -
O2T11_RS07610 (O2T11_07610) 1533216..1533554 + 339 WP_237769885.1 DUF523 domain-containing protein -
O2T11_RS07615 (O2T11_07615) 1533547..1533636 + 90 WP_072611711.1 DUF3265 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1346526..1705436 358910
- inside Integron - - 1462316..1534649 72333


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-83)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(12-75)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11261.25 Da        Isoelectric Point: 10.5932

>T266412 WP_005377002.1 NZ_CP114186:c1528602-1528312 [Vibrio parahaemolyticus]
MTYKLDFKKSALKEWKKLGSTLQQQFKKKLIERLDNPHVPASKLSGADNMYKIKLRQSGYRLVYKVEDDVIIVTVLAVGK
RERSDVYRKAMKRLDD

Download         Length: 291 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 9079.37 Da        Isoelectric Point: 3.9610

>AT266412 WP_005377003.1 NZ_CP114186:c1528840-1528592 [Vibrio parahaemolyticus]
MTTRILADVAASITELKANPMKVATSAYGEPVAVLNRNEPAFYCVPAEAYEMMMDRLEDLELLAIAKERESEESISVNID
DL

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A347UR03

Antitoxin

Source ID Structure
AlphaFold DB A0A347UR02

References