Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-YefM
Location 1519197..1519742 Replicon chromosome
Accession NZ_CP114186
Organism Vibrio parahaemolyticus strain PH1273

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag O2T11_RS07440 Protein ID WP_025559895.1
Coordinates 1519197..1519493 (-) Length 99 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID -
Locus tag O2T11_RS07445 Protein ID WP_023585842.1
Coordinates 1519500..1519742 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O2T11_RS07390 (O2T11_07390) 1514341..1514430 + 90 WP_234499175.1 DUF3265 domain-containing protein -
O2T11_RS07395 (O2T11_07395) 1514990..1515040 + 51 WP_237769876.1 hypothetical protein -
O2T11_RS07400 (O2T11_07400) 1515084..1515500 + 417 WP_031791315.1 hypothetical protein -
O2T11_RS07405 (O2T11_07405) 1515494..1515613 + 120 WP_078235925.1 DUF3265 domain-containing protein -
O2T11_RS07410 (O2T11_07410) 1515659..1516369 + 711 WP_031857096.1 SEC-C domain-containing protein -
O2T11_RS07415 (O2T11_07415) 1516512..1516925 + 414 WP_031857095.1 hypothetical protein -
O2T11_RS07420 (O2T11_07420) 1518095..1518487 + 393 WP_029823839.1 SMI1/KNR4 family protein -
O2T11_RS07425 (O2T11_07425) 1518502..1518594 + 93 WP_193230313.1 DUF3265 domain-containing protein -
O2T11_RS07430 (O2T11_07430) 1518621..1519028 + 408 WP_021485184.1 hypothetical protein -
O2T11_RS07435 (O2T11_07435) 1519043..1519135 + 93 WP_078235884.1 DUF3265 domain-containing protein -
O2T11_RS07440 (O2T11_07440) 1519197..1519493 - 297 WP_025559895.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
O2T11_RS07445 (O2T11_07445) 1519500..1519742 - 243 WP_023585842.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
O2T11_RS07450 (O2T11_07450) 1519869..1519946 + 78 WP_078235893.1 DUF3265 domain-containing protein -
O2T11_RS07455 (O2T11_07455) 1520133..1520450 + 318 WP_140059092.1 hypothetical protein -
O2T11_RS07460 (O2T11_07460) 1520434..1520568 + 135 Protein_1441 DUF3265 domain-containing protein -
O2T11_RS07465 (O2T11_07465) 1521070..1521288 + 219 WP_064490388.1 hypothetical protein -
O2T11_RS07470 (O2T11_07470) 1521504..1521788 + 285 WP_029823855.1 MazG nucleotide pyrophosphohydrolase domain-containing protein -
O2T11_RS07475 (O2T11_07475) 1521766..1521906 + 141 WP_140079567.1 DUF3265 domain-containing protein -
O2T11_RS07480 (O2T11_07480) 1522396..1522473 + 78 Protein_1445 DUF3265 domain-containing protein -
O2T11_RS07485 (O2T11_07485) 1522627..1523094 + 468 WP_031857408.1 cold shock domain-containing protein -
O2T11_RS07490 (O2T11_07490) 1523102..1523212 + 111 WP_193272087.1 DUF3265 domain-containing protein -
O2T11_RS07495 (O2T11_07495) 1523239..1523832 + 594 WP_029823788.1 hypothetical protein -
O2T11_RS07500 (O2T11_07500) 1523843..1523947 + 105 WP_229616293.1 DUF3265 domain-containing protein -
O2T11_RS07505 (O2T11_07505) 1524351..1524494 + 144 WP_072611506.1 DUF3265 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1346526..1705436 358910
- inside Integron - - 1462316..1534649 72333


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-93)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-54)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11305.96 Da        Isoelectric Point: 9.3813

>T266411 WP_025559895.1 NZ_CP114186:c1519493-1519197 [Vibrio parahaemolyticus]
MQKNKYKLSKLAQAHLLKIKNYTVNNFSEMQWRNYKDTLLTGFQMLADNPEVGRSCDDIYPNGFHFPVGKHTAYFTKEDG
FILVVAVLGQSQLPQNHL

Download         Length: 297 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8917.15 Da        Isoelectric Point: 5.1006

>AT266411 WP_023585842.1 NZ_CP114186:c1519742-1519500 [Vibrio parahaemolyticus]
MHTLTANDAKRNFGELLLSAQREPVKISKNSKDAVVVMSIKDYEELEAMKADYLKHCFESAKKDLAQGNVVDGEDFLSAL

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References