Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/Phd(antitoxin)
Location 1439400..1439947 Replicon chromosome
Accession NZ_CP114186
Organism Vibrio parahaemolyticus strain PH1273

Toxin (Protein)


Gene name relE Uniprot ID A0A347UR19
Locus tag O2T11_RS06710 Protein ID WP_025548916.1
Coordinates 1439645..1439947 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID U3A269
Locus tag O2T11_RS06705 Protein ID WP_005448240.1
Coordinates 1439400..1439657 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O2T11_RS06665 (O2T11_06665) 1434415..1434507 + 93 WP_078236017.1 DUF3265 domain-containing protein -
O2T11_RS06670 (O2T11_06670) 1434553..1435503 + 951 WP_283658310.1 putative phage abortive infection protein -
O2T11_RS06675 (O2T11_06675) 1435665..1435907 + 243 WP_050550698.1 hypothetical protein -
O2T11_RS06680 (O2T11_06680) 1435883..1436566 + 684 WP_283658311.1 ankyrin repeat domain-containing protein -
O2T11_RS06685 (O2T11_06685) 1436704..1437114 + 411 WP_283658312.1 hypothetical protein -
O2T11_RS06690 (O2T11_06690) 1438762..1438812 + 51 WP_237769876.1 hypothetical protein -
O2T11_RS06695 (O2T11_06695) 1438894..1439211 + 318 WP_141683043.1 hypothetical protein -
O2T11_RS06700 (O2T11_06700) 1439226..1439318 + 93 Protein_1289 DUF3265 domain-containing protein -
O2T11_RS06705 (O2T11_06705) 1439400..1439657 + 258 WP_005448240.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
O2T11_RS06710 (O2T11_06710) 1439645..1439947 + 303 WP_025548916.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
O2T11_RS06715 (O2T11_06715) 1440216..1440419 + 204 WP_029823873.1 hypothetical protein -
O2T11_RS06720 (O2T11_06720) 1440596..1441513 + 918 WP_029823727.1 hypothetical protein -
O2T11_RS06725 (O2T11_06725) 1441928..1442020 + 93 WP_202817042.1 DUF3265 domain-containing protein -
O2T11_RS06730 (O2T11_06730) 1442587..1442898 + 312 WP_283658313.1 hypothetical protein -
O2T11_RS06735 (O2T11_06735) 1443039..1443414 + 376 Protein_1296 hypothetical protein -
O2T11_RS06740 (O2T11_06740) 1443656..1443898 + 243 WP_080765108.1 zinc ribbon domain-containing protein -
O2T11_RS06745 (O2T11_06745) 1443924..1444016 + 93 WP_078235736.1 DUF3265 domain-containing protein -
O2T11_RS06750 (O2T11_06750) 1444060..1444614 + 555 WP_064490371.1 YdcF family protein -
O2T11_RS06755 (O2T11_06755) 1444629..1444721 + 93 WP_078235739.1 DUF3265 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1346526..1705436 358910
- inside Integron - - 1423889..1456694 32805


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-69)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11669.57 Da        Isoelectric Point: 5.1765

>T266410 WP_025548916.1 NZ_CP114186:1439645-1439947 [Vibrio parahaemolyticus]
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPELEHLSYREVVVNPCRVFYKQDGDKV
FILFVMRAERDLRKFLLSKQ

Download         Length: 303 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9606.10 Da        Isoelectric Point: 6.7269

>AT266410 WP_005448240.1 NZ_CP114186:1439400-1439657 [Vibrio parahaemolyticus]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLVDVDDYEFMQNRLAILEGIARGERALADGKVVSHDEAKDKM
SKWLK

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A347UR19

Antitoxin

Source ID Structure
AlphaFold DB A0A432DGX8

References