Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
| Location | 1256686..1257603 | Replicon | chromosome |
| Accession | NZ_CP114180 | ||
| Organism | Bacillus velezensis strain DMW1 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | I2HQ15 |
| Locus tag | M1L51_RS06445 | Protein ID | WP_007407256.1 |
| Coordinates | 1256857..1257603 (-) | Length | 249 a.a. |
Antitoxin (Protein)
| Gene name | spoIISB | Uniprot ID | I2HQ14 |
| Locus tag | M1L51_RS06440 | Protein ID | WP_003154807.1 |
| Coordinates | 1256686..1256856 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1L51_RS06405 | 1251897..1253486 | + | 1590 | WP_053573489.1 | hypothetical protein | - |
| M1L51_RS06410 | 1253499..1253924 | + | 426 | WP_053573490.1 | hypothetical protein | - |
| M1L51_RS06415 | 1253929..1254126 | + | 198 | WP_012117366.1 | XkdX family protein | - |
| M1L51_RS06420 | 1254183..1254944 | + | 762 | WP_053573491.1 | hypothetical protein | - |
| M1L51_RS06425 | 1254996..1255259 | + | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
| M1L51_RS06430 | 1255273..1255536 | + | 264 | WP_003154813.1 | phage holin | - |
| M1L51_RS06435 | 1255550..1256428 | + | 879 | WP_007407257.1 | N-acetylmuramoyl-L-alanine amidase | - |
| M1L51_RS06440 | 1256686..1256856 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
| M1L51_RS06445 | 1256857..1257603 | - | 747 | WP_007407256.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
| M1L51_RS06450 | 1257707..1258705 | - | 999 | WP_003154805.1 | inorganic phosphate transporter | - |
| M1L51_RS06455 | 1258718..1259335 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
| M1L51_RS06460 | 1259621..1260937 | - | 1317 | WP_007610842.1 | amino acid permease | - |
| M1L51_RS06465 | 1261260..1262210 | + | 951 | WP_031378808.1 | ring-cleaving dioxygenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1222155..1265865 | 43710 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29077.57 Da Isoelectric Point: 4.7755
>T266409 WP_007407256.1 NZ_CP114180:c1257603-1256857 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|