Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 521230..521867 | Replicon | chromosome |
Accession | NZ_CP114180 | ||
Organism | Bacillus velezensis strain DMW1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | M1L51_RS02485 | Protein ID | WP_003156187.1 |
Coordinates | 521517..521867 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | M1L51_RS02480 | Protein ID | WP_003156188.1 |
Coordinates | 521230..521511 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M1L51_RS02460 | 517595..518194 | - | 600 | WP_053573675.1 | rhomboid family intramembrane serine protease | - |
M1L51_RS02465 | 518287..518652 | + | 366 | WP_015416872.1 | holo-ACP synthase | - |
M1L51_RS02470 | 518817..519824 | + | 1008 | WP_007410230.1 | outer membrane lipoprotein carrier protein LolA | - |
M1L51_RS02475 | 519941..521110 | + | 1170 | WP_053573676.1 | alanine racemase | - |
M1L51_RS02480 | 521230..521511 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
M1L51_RS02485 | 521517..521867 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
M1L51_RS02490 | 521985..522806 | + | 822 | WP_033575045.1 | STAS domain-containing protein | - |
M1L51_RS02495 | 522811..523176 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
M1L51_RS02500 | 523179..523580 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
M1L51_RS02505 | 523592..524599 | + | 1008 | WP_003156177.1 | PP2C family protein-serine/threonine phosphatase | - |
M1L51_RS02510 | 524663..524992 | + | 330 | WP_033575044.1 | anti-sigma factor antagonist | - |
M1L51_RS02515 | 524989..525471 | + | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
M1L51_RS02520 | 525437..526225 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
M1L51_RS02525 | 526225..526827 | + | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T266408 WP_003156187.1 NZ_CP114180:521517-521867 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|