Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF(toxin)
Location 532879..533515 Replicon chromosome
Accession NZ_CP114177
Organism Bacillus safensis strain PLA 1006

Toxin (Protein)


Gene name mazF Uniprot ID A0A0P7G713
Locus tag O0R49_RS02630 Protein ID WP_024425388.1
Coordinates 533165..533515 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID W8QJ31
Locus tag O0R49_RS02625 Protein ID WP_003214273.1
Coordinates 532879..533160 (+) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O0R49_RS02605 (O0R49_02605) 529037..529642 - 606 WP_144472946.1 rhomboid family intramembrane serine protease -
O0R49_RS02610 (O0R49_02610) 529737..530102 + 366 WP_111289818.1 holo-ACP synthase -
O0R49_RS02615 (O0R49_02615) 530263..531279 + 1017 WP_095407802.1 outer membrane lipoprotein carrier protein LolA -
O0R49_RS02620 (O0R49_02620) 531419..532585 + 1167 WP_269195995.1 alanine racemase -
O0R49_RS02625 (O0R49_02625) 532879..533160 + 282 WP_003214273.1 hypothetical protein Antitoxin
O0R49_RS02630 (O0R49_02630) 533165..533515 + 351 WP_024425388.1 type II toxin-antitoxin system endoribonuclease NdoA Toxin
O0R49_RS02635 (O0R49_02635) 533633..534463 + 831 WP_024427375.1 RsbT co-antagonist protein RsbRA -
O0R49_RS02640 (O0R49_02640) 534468..534836 + 369 WP_003214235.1 RsbT antagonist protein RsbS -
O0R49_RS02645 (O0R49_02645) 534839..535240 + 402 WP_024427376.1 anti-sigma regulatory factor -
O0R49_RS02650 (O0R49_02650) 535251..536258 + 1008 WP_095407804.1 PP2C family protein-serine/threonine phosphatase -
O0R49_RS02655 (O0R49_02655) 536318..536647 + 330 WP_017358393.1 anti-sigma factor antagonist -
O0R49_RS02660 (O0R49_02660) 536644..537132 + 489 WP_048240335.1 anti-sigma B factor RsbW -
O0R49_RS02665 (O0R49_02665) 537098..537886 + 789 WP_024427378.1 RNA polymerase sigma factor SigB -
O0R49_RS02670 (O0R49_02670) 537886..538485 + 600 WP_205183263.1 PP2C family serine/threonine-protein phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(4-110)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 12977.98 Da        Isoelectric Point: 4.8891

>T266407 WP_024425388.1 NZ_CP114177:533165-533515 [Bacillus safensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF

Download         Length: 351 bp

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10864.25 Da        Isoelectric Point: 5.2726

>AT266407 WP_003214273.1 NZ_CP114177:532879-533160 [Bacillus safensis]
MSESSATNEMKIRLPEALMSEIERVAEQDKVTRNELIYRATKTYIRERNIRQNRESMRRGYMEMAKINLNISSEAQYAEF
EAENTVERLVSGG

Download         Length: 282 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0P7G713

Antitoxin

Source ID Structure
AlphaFold DB A0A081L854

References