Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 532879..533515 | Replicon | chromosome |
| Accession | NZ_CP114177 | ||
| Organism | Bacillus safensis strain PLA 1006 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A0P7G713 |
| Locus tag | O0R49_RS02630 | Protein ID | WP_024425388.1 |
| Coordinates | 533165..533515 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | W8QJ31 |
| Locus tag | O0R49_RS02625 | Protein ID | WP_003214273.1 |
| Coordinates | 532879..533160 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O0R49_RS02605 (O0R49_02605) | 529037..529642 | - | 606 | WP_144472946.1 | rhomboid family intramembrane serine protease | - |
| O0R49_RS02610 (O0R49_02610) | 529737..530102 | + | 366 | WP_111289818.1 | holo-ACP synthase | - |
| O0R49_RS02615 (O0R49_02615) | 530263..531279 | + | 1017 | WP_095407802.1 | outer membrane lipoprotein carrier protein LolA | - |
| O0R49_RS02620 (O0R49_02620) | 531419..532585 | + | 1167 | WP_269195995.1 | alanine racemase | - |
| O0R49_RS02625 (O0R49_02625) | 532879..533160 | + | 282 | WP_003214273.1 | hypothetical protein | Antitoxin |
| O0R49_RS02630 (O0R49_02630) | 533165..533515 | + | 351 | WP_024425388.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| O0R49_RS02635 (O0R49_02635) | 533633..534463 | + | 831 | WP_024427375.1 | RsbT co-antagonist protein RsbRA | - |
| O0R49_RS02640 (O0R49_02640) | 534468..534836 | + | 369 | WP_003214235.1 | RsbT antagonist protein RsbS | - |
| O0R49_RS02645 (O0R49_02645) | 534839..535240 | + | 402 | WP_024427376.1 | anti-sigma regulatory factor | - |
| O0R49_RS02650 (O0R49_02650) | 535251..536258 | + | 1008 | WP_095407804.1 | PP2C family protein-serine/threonine phosphatase | - |
| O0R49_RS02655 (O0R49_02655) | 536318..536647 | + | 330 | WP_017358393.1 | anti-sigma factor antagonist | - |
| O0R49_RS02660 (O0R49_02660) | 536644..537132 | + | 489 | WP_048240335.1 | anti-sigma B factor RsbW | - |
| O0R49_RS02665 (O0R49_02665) | 537098..537886 | + | 789 | WP_024427378.1 | RNA polymerase sigma factor SigB | - |
| O0R49_RS02670 (O0R49_02670) | 537886..538485 | + | 600 | WP_205183263.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8891
>T266407 WP_024425388.1 NZ_CP114177:533165-533515 [Bacillus safensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0P7G713 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A081L854 |