Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
Location | 583253..583903 | Replicon | chromosome |
Accession | NZ_CP114176 | ||
Organism | Lentibacillus sp. ZS110521 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | O2S85_RS03090 | Protein ID | WP_269411288.1 |
Coordinates | 583544..583903 (+) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | O2S85_RS03085 | Protein ID | WP_269411287.1 |
Coordinates | 583253..583540 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O2S85_RS03065 | 578453..578827 | + | 375 | WP_269411284.1 | holo-ACP synthase | - |
O2S85_RS03070 | 579085..580593 | + | 1509 | WP_269411285.1 | NAD(P)H-hydrate dehydratase | - |
O2S85_RS03075 | 580681..581742 | + | 1062 | WP_269411286.1 | outer membrane lipoprotein carrier protein LolA | - |
O2S85_RS03080 | 581913..583043 | + | 1131 | WP_269412454.1 | alanine racemase | - |
O2S85_RS03085 | 583253..583540 | + | 288 | WP_269411287.1 | antitoxin | Antitoxin |
O2S85_RS03090 | 583544..583903 | + | 360 | WP_269411288.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
O2S85_RS03095 | 584063..584932 | + | 870 | WP_269411289.1 | RsbT co-antagonist protein RsbRA | - |
O2S85_RS03100 | 584939..585295 | + | 357 | WP_269411290.1 | STAS domain-containing protein | - |
O2S85_RS03105 | 585297..585698 | + | 402 | WP_269411291.1 | anti-sigma regulatory factor | - |
O2S85_RS03110 | 585782..586792 | + | 1011 | WP_269411292.1 | PP2C family protein-serine/threonine phosphatase | - |
O2S85_RS03115 | 586877..587209 | + | 333 | WP_269411293.1 | STAS domain-containing protein | - |
O2S85_RS03120 | 587209..587685 | + | 477 | WP_269412455.1 | anti-sigma B factor RsbW | - |
O2S85_RS03125 | 587657..588448 | + | 792 | WP_269411294.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13378.61 Da Isoelectric Point: 9.4870
>T266406 WP_269411288.1 NZ_CP114176:583544-583903 [Lentibacillus sp. ZS110521]
MIVQRGEVYFADLSPVVGSEQGGIRPVLILQNDIGNRFSPTVIIAAITAQIQKAKLPTHVEINAKRYGFDRNSVILLEQI
RTLDKQRLTDKITKLDKEMMEKINHALEISLGLKDMYGS
MIVQRGEVYFADLSPVVGSEQGGIRPVLILQNDIGNRFSPTVIIAAITAQIQKAKLPTHVEINAKRYGFDRNSVILLEQI
RTLDKQRLTDKITKLDKEMMEKINHALEISLGLKDMYGS
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|