Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 69851..70587 | Replicon | plasmid unnamed1 |
Accession | NZ_CP114169 | ||
Organism | Klebsiella variicola strain 2022CK-00565 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | L7SZ15 |
Locus tag | OIX89_RS27285 | Protein ID | WP_003026803.1 |
Coordinates | 70105..70587 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | OIX89_RS27280 | Protein ID | WP_003026799.1 |
Coordinates | 69851..70117 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OIX89_RS27245 (OIX89_27245) | 65695..66057 | - | 363 | WP_004206665.1 | arsenite efflux transporter metallochaperone ArsD | - |
OIX89_RS27250 (OIX89_27250) | 66109..66459 | - | 351 | WP_004206664.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
OIX89_RS27255 (OIX89_27255) | 66817..67065 | + | 249 | WP_004193994.1 | hypothetical protein | - |
OIX89_RS27260 (OIX89_27260) | 67062..68273 | + | 1212 | WP_032415728.1 | hypothetical protein | - |
OIX89_RS27265 (OIX89_27265) | 68407..68898 | + | 492 | WP_004206662.1 | hypothetical protein | - |
OIX89_RS27270 (OIX89_27270) | 68959..69162 | + | 204 | WP_004206661.1 | HHA domain-containing protein | - |
OIX89_RS27275 (OIX89_27275) | 69176..69406 | + | 231 | WP_004206660.1 | hypothetical protein | - |
OIX89_RS27280 (OIX89_27280) | 69851..70117 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
OIX89_RS27285 (OIX89_27285) | 70105..70587 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
OIX89_RS27290 (OIX89_27290) | 70788..72191 | + | 1404 | WP_001567368.1 | ISNCY-like element ISKpn21 family transposase | - |
OIX89_RS27295 (OIX89_27295) | 72220..72852 | - | 633 | WP_001567369.1 | hypothetical protein | - |
OIX89_RS27300 (OIX89_27300) | 73078..74424 | + | 1347 | WP_064152331.1 | ISNCY family transposase | - |
OIX89_RS27305 (OIX89_27305) | 74473..74868 | + | 396 | WP_048268429.1 | helix-turn-helix domain-containing protein | - |
OIX89_RS27310 (OIX89_27310) | 75021..75131 | - | 111 | Protein_79 | IS3 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..239010 | 239010 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T266404 WP_003026803.1 NZ_CP114169:70105-70587 [Klebsiella variicola]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J2GNW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |