Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 3541494..3542045 | Replicon | chromosome |
Accession | NZ_CP114168 | ||
Organism | Klebsiella variicola strain 2022CK-00565 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A2V3KRZ7 |
Locus tag | OIX89_RS16960 | Protein ID | WP_046881584.1 |
Coordinates | 3541494..3541826 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A2V3KU66 |
Locus tag | OIX89_RS16965 | Protein ID | WP_046881585.1 |
Coordinates | 3541827..3542045 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OIX89_RS16930 (OIX89_16930) | 3537260..3538360 | - | 1101 | WP_070612302.1 | AarF/UbiB family protein | - |
OIX89_RS16935 (OIX89_16935) | 3538887..3539144 | + | 258 | WP_012541132.1 | antitoxin | - |
OIX89_RS16940 (OIX89_16940) | 3539145..3539477 | + | 333 | WP_008804165.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
OIX89_RS16950 (OIX89_16950) | 3539800..3541236 | + | 1437 | WP_269136626.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
OIX89_RS16960 (OIX89_16960) | 3541494..3541826 | - | 333 | WP_046881584.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OIX89_RS16965 (OIX89_16965) | 3541827..3542045 | - | 219 | WP_046881585.1 | antitoxin | Antitoxin |
OIX89_RS16970 (OIX89_16970) | 3542357..3543337 | - | 981 | WP_000019445.1 | IS5-like element ISKpn26 family transposase | - |
OIX89_RS16975 (OIX89_16975) | 3543433..3545367 | + | 1935 | WP_046881586.1 | P-loop NTPase fold protein | - |
OIX89_RS16980 (OIX89_16980) | 3545367..3546233 | + | 867 | WP_046881587.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3539145..3553064 | 13919 | |
- | flank | IS/Tn | - | - | 3542357..3543337 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11751.64 Da Isoelectric Point: 10.8919
>T266397 WP_046881584.1 NZ_CP114168:c3541826-3541494 [Klebsiella variicola]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKAAFNKQTRLPVVVPVTSGGNFARATGFTVSLDGVGTKTTGVLRCDQPRTI
VMGARSGKRLERIPDAVVNEVLARLDAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKAAFNKQTRLPVVVPVTSGGNFARATGFTVSLDGVGTKTTGVLRCDQPRTI
VMGARSGKRLERIPDAVVNEVLARLDAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2V3KRZ7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2V3KU66 |