Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hipBA/HipA-couple_hipB |
Location | 3351454..3352451 | Replicon | chromosome |
Accession | NZ_CP114168 | ||
Organism | Klebsiella variicola strain 2022CK-00565 |
Toxin (Protein)
Gene name | hipA | Uniprot ID | - |
Locus tag | OIX89_RS16125 | Protein ID | WP_229531768.1 |
Coordinates | 3351897..3352451 (-) | Length | 185 a.a. |
Antitoxin (Protein)
Gene name | hipB | Uniprot ID | A0A1F2MDT5 |
Locus tag | OIX89_RS16120 | Protein ID | WP_012541033.1 |
Coordinates | 3351454..3351900 (-) | Length | 149 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OIX89_RS16105 (OIX89_16105) | 3347749..3348747 | + | 999 | WP_008804028.1 | galactose/glucose ABC transporter substrate-binding protein MglB | - |
OIX89_RS16110 (OIX89_16110) | 3348866..3350386 | + | 1521 | WP_008804029.1 | galactose/methyl galactoside ABC transporter ATP-binding protein MglA | - |
OIX89_RS16115 (OIX89_16115) | 3350402..3351412 | + | 1011 | WP_002912871.1 | galactose/methyl galactoside ABC transporter permease MglC | - |
OIX89_RS16120 (OIX89_16120) | 3351454..3351900 | - | 447 | WP_012541033.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OIX89_RS16125 (OIX89_16125) | 3351897..3352451 | - | 555 | WP_229531768.1 | HipA domain-containing protein | Toxin |
OIX89_RS16130 (OIX89_16130) | 3352480..3353001 | - | 522 | WP_025714688.1 | hypothetical protein | - |
OIX89_RS16135 (OIX89_16135) | 3353116..3353847 | - | 732 | WP_008804033.1 | outer membrane permeability protein SanA | - |
OIX89_RS16140 (OIX89_16140) | 3354140..3355024 | - | 885 | WP_262266825.1 | cytidine deaminase | - |
OIX89_RS16145 (OIX89_16145) | 3355153..3355848 | - | 696 | WP_061153873.1 | CidB/LrgB family autolysis modulator | - |
OIX89_RS16150 (OIX89_16150) | 3355838..3356242 | - | 405 | WP_004201620.1 | CidA/LrgA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 185 a.a. Molecular weight: 20710.03 Da Isoelectric Point: 5.7891
>T266395 WP_229531768.1 NZ_CP114168:c3352451-3351897 [Klebsiella variicola]
MRLGMESVYSLLQKAPATILDHETTLRILIEKITSSNMVRVQNYRFDVQGFIIDWVRRDLLNIIFGNSDNHGRNTAFMKA
DNEIILAPIYDFAPMKADPEGIPRTMKWSLACESGGEYNFGAIAQALAEWITPDTLLNALSETASQLVDLPSRLKVRGVP
VQILEMPSIGFKFIPDKLARWGLL
MRLGMESVYSLLQKAPATILDHETTLRILIEKITSSNMVRVQNYRFDVQGFIIDWVRRDLLNIIFGNSDNHGRNTAFMKA
DNEIILAPIYDFAPMKADPEGIPRTMKWSLACESGGEYNFGAIAQALAEWITPDTLLNALSETASQLVDLPSRLKVRGVP
VQILEMPSIGFKFIPDKLARWGLL
Download Length: 555 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16396.05 Da Isoelectric Point: 10.5417
>AT266395 WP_012541033.1 NZ_CP114168:c3351900-3351454 [Klebsiella variicola]
MKTLNKKETEIQNTLARLRADNPPSLPATGVTATEKKARSEISRQRVSAGLKKVKTVDRQAVIHAIIHDIMLGAISQGEA
LKKLRVEVLGLRQDEYARLVDVSRKTLSDVENDKGNYSAEIINKIYKPFGLETGLVPISKTLISSLFK
MKTLNKKETEIQNTLARLRADNPPSLPATGVTATEKKARSEISRQRVSAGLKKVKTVDRQAVIHAIIHDIMLGAISQGEA
LKKLRVEVLGLRQDEYARLVDVSRKTLSDVENDKGNYSAEIINKIYKPFGLETGLVPISKTLISSLFK
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|