Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 1970779..1971365 Replicon chromosome
Accession NZ_CP114168
Organism Klebsiella variicola strain 2022CK-00565

Toxin (Protein)


Gene name doc Uniprot ID A0A2W7TCK5
Locus tag OIX89_RS09295 Protein ID WP_008806973.1
Coordinates 1970997..1971365 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag OIX89_RS09290 Protein ID WP_004174006.1
Coordinates 1970779..1971000 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OIX89_RS09270 (OIX89_09270) 1966928..1967854 + 927 WP_012540389.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
OIX89_RS09275 (OIX89_09275) 1967851..1969128 + 1278 WP_008806971.1 branched chain amino acid ABC transporter permease LivM -
OIX89_RS09280 (OIX89_09280) 1969125..1969892 + 768 WP_008806972.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
OIX89_RS09285 (OIX89_09285) 1969894..1970607 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
OIX89_RS09290 (OIX89_09290) 1970779..1971000 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OIX89_RS09295 (OIX89_09295) 1970997..1971365 + 369 WP_008806973.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OIX89_RS09300 (OIX89_09300) 1971657..1972973 + 1317 WP_269136587.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
OIX89_RS09305 (OIX89_09305) 1973075..1973962 + 888 WP_012967120.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
OIX89_RS09310 (OIX89_09310) 1973959..1974804 + 846 WP_048268283.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
OIX89_RS09315 (OIX89_09315) 1974806..1975876 + 1071 WP_044649551.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1967851..1976613 8762


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(6-116)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13639.01 Da        Isoelectric Point: 7.3191

>T266392 WP_008806973.1 NZ_CP114168:1970997-1971365 [Klebsiella variicola]
MTLQIISAEEIIQFHDRLLRVTPDVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLVISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT266392 WP_004174006.1 NZ_CP114168:1970779-1971000 [Klebsiella variicola]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2W7TCK5

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References