Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 1929945..1930576 | Replicon | chromosome |
Accession | NZ_CP114168 | ||
Organism | Klebsiella variicola strain 2022CK-00565 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A2V3KJT3 |
Locus tag | OIX89_RS09085 | Protein ID | WP_044650325.1 |
Coordinates | 1929945..1930220 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | R4YIG2 |
Locus tag | OIX89_RS09090 | Protein ID | WP_004181489.1 |
Coordinates | 1930217..1930576 (+) | Length | 120 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OIX89_RS09065 (OIX89_09065) | 1925181..1925516 | + | 336 | WP_002921203.1 | universal stress protein UspB | - |
OIX89_RS09070 (OIX89_09070) | 1925576..1927072 | - | 1497 | WP_008806938.1 | inorganic phosphate transporter PitA | - |
OIX89_RS09075 (OIX89_09075) | 1927302..1928495 | + | 1194 | WP_012967106.1 | NAD(P)/FAD-dependent oxidoreductase | - |
OIX89_RS09080 (OIX89_09080) | 1928535..1929548 | - | 1014 | WP_008806942.1 | magnesium transporter | - |
OIX89_RS09085 (OIX89_09085) | 1929945..1930220 | + | 276 | WP_044650325.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
OIX89_RS09090 (OIX89_09090) | 1930217..1930576 | + | 360 | WP_004181489.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
OIX89_RS09095 (OIX89_09095) | 1930604..1931005 | - | 402 | WP_032733900.1 | nickel-responsive transcriptional regulator NikR | - |
OIX89_RS09100 (OIX89_09100) | 1930993..1931784 | - | 792 | WP_012540373.1 | nickel import ATP-binding protein NikE | - |
OIX89_RS09105 (OIX89_09105) | 1931781..1932545 | - | 765 | WP_008806946.1 | nickel import ATP-binding protein NikD | - |
OIX89_RS09110 (OIX89_09110) | 1932545..1933378 | - | 834 | WP_012967107.1 | nickel ABC transporter permease subunit NikC | - |
OIX89_RS09115 (OIX89_09115) | 1933375..1934319 | - | 945 | WP_016161924.1 | nickel ABC transporter permease subunit NikB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10279.91 Da Isoelectric Point: 10.3165
>T266391 WP_044650325.1 NZ_CP114168:1929945-1930220 [Klebsiella variicola]
MEQQVLSLRNKQRHTLEQLFKIPVPQGIKWADIESLIKALGGEIKEGRGSRCKFLLNHSIASFHRPHPSPDTDKGAVESV
RDWLITIGVKP
MEQQVLSLRNKQRHTLEQLFKIPVPQGIKWADIESLIKALGGEIKEGRGSRCKFLLNHSIASFHRPHPSPDTDKGAVESV
RDWLITIGVKP
Download Length: 276 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13313.02 Da Isoelectric Point: 4.4605
>AT266391 WP_004181489.1 NZ_CP114168:1930217-1930576 [Klebsiella variicola]
MIKPKTPNSMEIAGQPAVINYVPELNAFRGKFLGLSGYCDFVSDSIQGLQQEGEISLQEYLADCHEAGIEPYAHPEKMKT
FTLRYPESFGERLSSAAAEEQVSVNTWILETLNERLKQA
MIKPKTPNSMEIAGQPAVINYVPELNAFRGKFLGLSGYCDFVSDSIQGLQQEGEISLQEYLADCHEAGIEPYAHPEKMKT
FTLRYPESFGERLSSAAAEEQVSVNTWILETLNERLKQA
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2V3KJT3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1F2M5Q1 |