Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 1550681..1551306 | Replicon | chromosome |
Accession | NZ_CP114168 | ||
Organism | Klebsiella variicola strain 2022CK-00565 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A1F2M041 |
Locus tag | OIX89_RS07360 | Protein ID | WP_008807903.1 |
Coordinates | 1550681..1551064 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | OIX89_RS07365 | Protein ID | WP_004150355.1 |
Coordinates | 1551064..1551306 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OIX89_RS07345 (OIX89_07345) | 1548047..1548949 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
OIX89_RS07350 (OIX89_07350) | 1548946..1549581 | + | 636 | WP_008807902.1 | formate dehydrogenase cytochrome b556 subunit | - |
OIX89_RS07355 (OIX89_07355) | 1549578..1550507 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
OIX89_RS07360 (OIX89_07360) | 1550681..1551064 | - | 384 | WP_008807903.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OIX89_RS07365 (OIX89_07365) | 1551064..1551306 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
OIX89_RS07370 (OIX89_07370) | 1551511..1552428 | + | 918 | WP_064171510.1 | alpha/beta hydrolase | - |
OIX89_RS07375 (OIX89_07375) | 1552442..1553383 | - | 942 | WP_012543287.1 | fatty acid biosynthesis protein FabY | - |
OIX89_RS07380 (OIX89_07380) | 1553428..1553865 | - | 438 | WP_008807906.1 | D-aminoacyl-tRNA deacylase | - |
OIX89_RS07385 (OIX89_07385) | 1553862..1554722 | - | 861 | WP_008807907.1 | virulence factor BrkB family protein | - |
OIX89_RS07390 (OIX89_07390) | 1554716..1555315 | - | 600 | WP_008807908.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T266390 WP_008807903.1 NZ_CP114168:c1551064-1550681 [Klebsiella variicola]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYELHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYELHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1F2M041 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |