Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 355289..355908 Replicon chromosome
Accession NZ_CP114168
Organism Klebsiella variicola strain 2022CK-00565

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OIX89_RS01690 Protein ID WP_002892050.1
Coordinates 355690..355908 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A1F2MBN7
Locus tag OIX89_RS01685 Protein ID WP_008805436.1
Coordinates 355289..355663 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OIX89_RS01675 (OIX89_01675) 350444..351637 + 1194 WP_012542667.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OIX89_RS01680 (OIX89_01680) 351660..354806 + 3147 WP_008805437.1 multidrug efflux RND transporter permease subunit AcrB -
OIX89_RS01685 (OIX89_01685) 355289..355663 + 375 WP_008805436.1 Hha toxicity modulator TomB Antitoxin
OIX89_RS01690 (OIX89_01690) 355690..355908 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OIX89_RS01695 (OIX89_01695) 356067..356633 + 567 WP_008805435.1 maltose O-acetyltransferase -
OIX89_RS01700 (OIX89_01700) 356605..356733 - 129 Protein_322 hypothetical protein -
OIX89_RS01705 (OIX89_01705) 356770..357240 + 471 WP_008805434.1 YlaC family protein -
OIX89_RS01710 (OIX89_01710) 357209..358666 - 1458 WP_110242785.1 PLP-dependent aminotransferase family protein -
OIX89_RS01715 (OIX89_01715) 358767..359465 + 699 WP_032438712.1 GNAT family protein -
OIX89_RS01720 (OIX89_01720) 359462..359602 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OIX89_RS01725 (OIX89_01725) 359602..359865 - 264 WP_008805431.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T266388 WP_002892050.1 NZ_CP114168:355690-355908 [Klebsiella variicola]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14384.06 Da        Isoelectric Point: 4.8989

>AT266388 WP_008805436.1 NZ_CP114168:355289-355663 [Klebsiella variicola]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYTEDNKLVAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A1F2MBN7

References