Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 1911496..1912086 | Replicon | chromosome |
| Accession | NZ_CP114164 | ||
| Organism | Klebsiella variicola strain 2022CK-00564 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | A0A1F2LYA2 |
| Locus tag | OIX91_RS09230 | Protein ID | WP_008804165.1 |
| Coordinates | 1911754..1912086 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A1F2LZQ3 |
| Locus tag | OIX91_RS09225 | Protein ID | WP_012541132.1 |
| Coordinates | 1911496..1911753 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OIX91_RS09205 (OIX91_09205) | 1907104..1907679 | + | 576 | WP_012541129.1 | hypothetical protein | - |
| OIX91_RS09210 (OIX91_09210) | 1907858..1908694 | + | 837 | WP_008804155.1 | alpha/beta hydrolase | - |
| OIX91_RS09215 (OIX91_09215) | 1908901..1909872 | + | 972 | WP_016161433.1 | sensor domain-containing diguanylate cyclase | - |
| OIX91_RS09220 (OIX91_09220) | 1909869..1910969 | - | 1101 | WP_070612302.1 | AarF/UbiB family protein | - |
| OIX91_RS09225 (OIX91_09225) | 1911496..1911753 | + | 258 | WP_012541132.1 | antitoxin | Antitoxin |
| OIX91_RS09230 (OIX91_09230) | 1911754..1912086 | + | 333 | WP_008804165.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| OIX91_RS09240 (OIX91_09240) | 1912409..1913845 | + | 1437 | WP_269136626.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
| OIX91_RS09250 (OIX91_09250) | 1914103..1914435 | - | 333 | WP_046881584.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| OIX91_RS09255 (OIX91_09255) | 1914436..1914654 | - | 219 | WP_046881585.1 | antitoxin | - |
| OIX91_RS09260 (OIX91_09260) | 1914966..1915946 | - | 981 | WP_000019445.1 | IS5-like element ISKpn26 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1914966..1915946 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11867.71 Da Isoelectric Point: 10.1839
>T266373 WP_008804165.1 NZ_CP114164:1911754-1912086 [Klebsiella variicola]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARNGKRLERIPDAVVNEVLARLDAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARNGKRLERIPDAVVNEVLARLDAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1F2LYA2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1F2LZQ3 |