Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 83220..83956 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP114161 | ||
| Organism | Klebsiella quasipneumoniae strain 2022CK-00516 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | L7SZ15 |
| Locus tag | N5B28_RS26240 | Protein ID | WP_003026803.1 |
| Coordinates | 83474..83956 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | N5B28_RS26235 | Protein ID | WP_003026799.1 |
| Coordinates | 83220..83486 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5B28_RS26210 (N5B28_26210) | 78686..79759 | + | 1074 | WP_017900354.1 | urea ABC transporter permease subunit UrtC | - |
| N5B28_RS26215 (N5B28_26215) | 79759..80556 | + | 798 | WP_004205978.1 | urea ABC transporter ATP-binding protein UrtD | - |
| N5B28_RS26220 (N5B28_26220) | 80566..81264 | + | 699 | WP_004205977.1 | urea ABC transporter ATP-binding subunit UrtE | - |
| N5B28_RS26225 (N5B28_26225) | 81300..81782 | - | 483 | WP_004205976.1 | helix-turn-helix domain-containing protein | - |
| N5B28_RS26230 (N5B28_26230) | 81842..82810 | + | 969 | WP_072202995.1 | IS5 family transposase | - |
| N5B28_RS26235 (N5B28_26235) | 83220..83486 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| N5B28_RS26240 (N5B28_26240) | 83474..83956 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
| N5B28_RS26245 (N5B28_26245) | 84168..85514 | + | 1347 | WP_077251107.1 | ISNCY family transposase | - |
| N5B28_RS26250 (N5B28_26250) | 85674..86378 | + | 705 | WP_031591821.1 | toll/interleukin-1 receptor domain-containing protein | - |
| N5B28_RS26255 (N5B28_26255) | 86713..86970 | - | 258 | WP_023292103.1 | hypothetical protein | - |
| N5B28_RS26260 (N5B28_26260) | 87613..88128 | + | 516 | Protein_95 | CSS-motif domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..175750 | 175750 | |
| - | inside | IScluster/Tn | - | - | 81842..85514 | 3672 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T266365 WP_003026803.1 NZ_CP114161:83474-83956 [Klebsiella quasipneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2GNW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |