Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 14700..15343 Replicon plasmid unnamed1
Accession NZ_CP114161
Organism Klebsiella quasipneumoniae strain 2022CK-00516

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag N5B28_RS25855 Protein ID WP_021312475.1
Coordinates 14927..15343 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A6B7Q5S4
Locus tag N5B28_RS25850 Protein ID WP_021312476.1
Coordinates 14700..14930 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5B28_RS25825 (N5B28_25825) 10043..10771 + 729 Protein_8 CSS-motif domain-containing protein -
N5B28_RS25830 (N5B28_25830) 10823..11623 + 801 WP_065905270.1 EAL domain-containing protein -
N5B28_RS25835 (N5B28_25835) 12310..13278 - 969 WP_078207718.1 IS5 family transposase -
N5B28_RS25840 (N5B28_25840) 13280..13753 - 474 WP_065905236.1 hypothetical protein -
N5B28_RS25845 (N5B28_25845) 13802..14095 - 294 WP_124989603.1 hypothetical protein -
N5B28_RS25850 (N5B28_25850) 14700..14930 + 231 WP_021312476.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N5B28_RS25855 (N5B28_25855) 14927..15343 + 417 WP_021312475.1 type II toxin-antitoxin system VapC family toxin Toxin
N5B28_RS25860 (N5B28_25860) 15378..15623 + 246 WP_065905238.1 hypothetical protein -
N5B28_RS25865 (N5B28_25865) 15687..15905 + 219 WP_021312527.1 hypothetical protein -
N5B28_RS25870 (N5B28_25870) 15984..16310 + 327 WP_124989605.1 hypothetical protein -
N5B28_RS25875 (N5B28_25875) 16550..16813 + 264 WP_004118691.1 hypothetical protein -
N5B28_RS25880 (N5B28_25880) 16810..17376 + 567 WP_009654312.1 hypothetical protein -
N5B28_RS25885 (N5B28_25885) 17407..17901 + 495 WP_016528789.1 hypothetical protein -
N5B28_RS25890 (N5B28_25890) 17962..18165 + 204 WP_004150739.1 HHA domain-containing protein -
N5B28_RS25895 (N5B28_25895) 18214..18471 + 258 WP_004098928.1 hypothetical protein -
N5B28_RS25900 (N5B28_25900) 18547..18801 + 255 WP_032731922.1 hypothetical protein -
N5B28_RS25905 (N5B28_25905) 19100..20104 - 1005 WP_065905242.1 IS110-like element IS5075 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..175750 175750
- flank IS/Tn - - 12310..13278 968


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15033.44 Da        Isoelectric Point: 7.8915

>T266364 WP_021312475.1 NZ_CP114161:14927-15343 [Klebsiella quasipneumoniae]
VKKTFMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHIELVDAFCARLDAILPWDRA
AVDATTEIKVALRQAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLVLEDWVN

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8723.76 Da        Isoelectric Point: 4.3410

>AT266364 WP_021312476.1 NZ_CP114161:14700-14930 [Klebsiella quasipneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFDL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A6B7Q5S4

References