Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4131881..4132500 Replicon chromosome
Accession NZ_CP114160
Organism Klebsiella quasipneumoniae strain 2022CK-00516

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag N5B28_RS19990 Protein ID WP_002892050.1
Coordinates 4132282..4132500 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag N5B28_RS19985 Protein ID WP_002892066.1
Coordinates 4131881..4132255 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5B28_RS19975 (4127034) 4127034..4128227 + 1194 WP_023288645.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
N5B28_RS19980 (4128250) 4128250..4131396 + 3147 WP_023288644.1 multidrug efflux RND transporter permease subunit AcrB -
N5B28_RS19985 (4131881) 4131881..4132255 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
N5B28_RS19990 (4132282) 4132282..4132500 + 219 WP_002892050.1 HHA domain-containing protein Toxin
N5B28_RS19995 (4132659) 4132659..4133225 + 567 WP_023288643.1 maltose O-acetyltransferase -
N5B28_RS20000 (4133197) 4133197..4133328 - 132 WP_162543094.1 hypothetical protein -
N5B28_RS20005 (4133362) 4133362..4133832 + 471 WP_064155186.1 YlaC family protein -
N5B28_RS20010 (4133801) 4133801..4135258 - 1458 WP_087824767.1 PLP-dependent aminotransferase family protein -
N5B28_RS20015 (4135359) 4135359..4136057 + 699 WP_117128677.1 GNAT family protein -
N5B28_RS20020 (4136054) 4136054..4136194 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
N5B28_RS20025 (4136194) 4136194..4136457 - 264 WP_004204754.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T266362 WP_002892050.1 NZ_CP114160:4132282-4132500 [Klebsiella quasipneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT266362 WP_002892066.1 NZ_CP114160:4131881-4132255 [Klebsiella quasipneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References