Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 145855..146498 | Replicon | plasmid unnamed1 |
Accession | NZ_CP114157 | ||
Organism | Klebsiella michiganensis strain 2022CK-00497 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | OEE44_RS28715 | Protein ID | WP_049111255.1 |
Coordinates | 145855..146271 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D5KTK7 |
Locus tag | OEE44_RS28720 | Protein ID | WP_001261282.1 |
Coordinates | 146268..146498 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEE44_RS28695 (OEE44_28695) | 141223..141573 | + | 351 | WP_004187110.1 | DUF305 domain-containing protein | - |
OEE44_RS28700 (OEE44_28700) | 141759..142667 | - | 909 | WP_032411229.1 | HNH endonuclease | - |
OEE44_RS28705 (OEE44_28705) | 143212..144234 | - | 1023 | WP_000361404.1 | helicase UvrD | - |
OEE44_RS28710 (OEE44_28710) | 144219..145781 | - | 1563 | WP_101881050.1 | AAA family ATPase | - |
OEE44_RS28715 (OEE44_28715) | 145855..146271 | - | 417 | WP_049111255.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OEE44_RS28720 (OEE44_28720) | 146268..146498 | - | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
OEE44_RS28725 (OEE44_28725) | 146455..146634 | + | 180 | Protein_160 | hypothetical protein | - |
OEE44_RS28730 (OEE44_28730) | 146691..147659 | - | 969 | WP_202861564.1 | IS5 family transposase | - |
OEE44_RS28735 (OEE44_28735) | 147639..147905 | + | 267 | WP_176240533.1 | IS66 family insertion sequence element accessory protein TnpB | - |
OEE44_RS28740 (OEE44_28740) | 148124..148666 | + | 543 | Protein_163 | transposase | - |
OEE44_RS28745 (OEE44_28745) | 148680..149564 | - | 885 | WP_060591199.1 | NAD(P)-dependent oxidoreductase | - |
OEE44_RS28750 (OEE44_28750) | 149609..150358 | - | 750 | WP_060591201.1 | fumarylacetoacetate hydrolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | pla | 1..173797 | 173797 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15122.52 Da Isoelectric Point: 7.1084
>T266354 WP_049111255.1 NZ_CP114157:c146271-145855 [Klebsiella michiganensis]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIASGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIASGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|