Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 145855..146498 Replicon plasmid unnamed1
Accession NZ_CP114157
Organism Klebsiella michiganensis strain 2022CK-00497

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag OEE44_RS28715 Protein ID WP_049111255.1
Coordinates 145855..146271 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag OEE44_RS28720 Protein ID WP_001261282.1
Coordinates 146268..146498 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OEE44_RS28695 (OEE44_28695) 141223..141573 + 351 WP_004187110.1 DUF305 domain-containing protein -
OEE44_RS28700 (OEE44_28700) 141759..142667 - 909 WP_032411229.1 HNH endonuclease -
OEE44_RS28705 (OEE44_28705) 143212..144234 - 1023 WP_000361404.1 helicase UvrD -
OEE44_RS28710 (OEE44_28710) 144219..145781 - 1563 WP_101881050.1 AAA family ATPase -
OEE44_RS28715 (OEE44_28715) 145855..146271 - 417 WP_049111255.1 type II toxin-antitoxin system VapC family toxin Toxin
OEE44_RS28720 (OEE44_28720) 146268..146498 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OEE44_RS28725 (OEE44_28725) 146455..146634 + 180 Protein_160 hypothetical protein -
OEE44_RS28730 (OEE44_28730) 146691..147659 - 969 WP_202861564.1 IS5 family transposase -
OEE44_RS28735 (OEE44_28735) 147639..147905 + 267 WP_176240533.1 IS66 family insertion sequence element accessory protein TnpB -
OEE44_RS28740 (OEE44_28740) 148124..148666 + 543 Protein_163 transposase -
OEE44_RS28745 (OEE44_28745) 148680..149564 - 885 WP_060591199.1 NAD(P)-dependent oxidoreductase -
OEE44_RS28750 (OEE44_28750) 149609..150358 - 750 WP_060591201.1 fumarylacetoacetate hydrolase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - pla 1..173797 173797


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15122.52 Da        Isoelectric Point: 7.1084

>T266354 WP_049111255.1 NZ_CP114157:c146271-145855 [Klebsiella michiganensis]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIASGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT266354 WP_001261282.1 NZ_CP114157:c146498-146268 [Klebsiella michiganensis]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References