Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 17328..18064 | Replicon | plasmid unnamed1 |
Accession | NZ_CP114157 | ||
Organism | Klebsiella michiganensis strain 2022CK-00497 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | OEE44_RS28030 | Protein ID | WP_060589645.1 |
Coordinates | 17328..17810 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | - |
Locus tag | OEE44_RS28035 | Protein ID | WP_032415032.1 |
Coordinates | 17798..18064 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEE44_RS28005 (OEE44_28005) | 12823..13248 | - | 426 | WP_000065802.1 | glutaredoxin-dependent arsenate reductase | - |
OEE44_RS28010 (OEE44_28010) | 13261..14550 | - | 1290 | WP_000922628.1 | arsenic transporter | - |
OEE44_RS28015 (OEE44_28015) | 14596..14916 | - | 321 | WP_000941305.1 | transcriptional regulator | - |
OEE44_RS28020 (OEE44_28020) | 15003..15707 | + | 705 | WP_062939642.1 | arsenical resistance protein ArsH | - |
OEE44_RS28025 (OEE44_28025) | 15740..17143 | - | 1404 | WP_060589555.1 | ISNCY family transposase | - |
OEE44_RS28030 (OEE44_28030) | 17328..17810 | - | 483 | WP_060589645.1 | GNAT family N-acetyltransferase | Toxin |
OEE44_RS28035 (OEE44_28035) | 17798..18064 | - | 267 | WP_032415032.1 | DUF1778 domain-containing protein | Antitoxin |
OEE44_RS28040 (OEE44_28040) | 18240..18494 | - | 255 | WP_060589646.1 | hypothetical protein | - |
OEE44_RS28045 (OEE44_28045) | 18898..19734 | - | 837 | WP_060589647.1 | EAL domain-containing protein | - |
OEE44_RS28050 (OEE44_28050) | 19750..20478 | - | 729 | Protein_25 | CSS-motif domain-containing protein | - |
OEE44_RS28055 (OEE44_28055) | 20956..21213 | + | 258 | WP_086074090.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | pla | 1..173797 | 173797 | |
- | inside | IScluster/Tn | - | - | 15740..30440 | 14700 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17339.05 Da Isoelectric Point: 10.0704
>T266352 WP_060589645.1 NZ_CP114157:c17810-17328 [Klebsiella michiganensis]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLT
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLT
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|