Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 5134673..5135249 | Replicon | chromosome |
| Accession | NZ_CP114156 | ||
| Organism | Klebsiella michiganensis strain 2022CK-00497 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | A0A443WNM0 |
| Locus tag | OEE44_RS24235 | Protein ID | WP_064380994.1 |
| Coordinates | 5134962..5135249 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A0H3H591 |
| Locus tag | OEE44_RS24230 | Protein ID | WP_014227757.1 |
| Coordinates | 5134673..5134975 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OEE44_RS24215 (OEE44_24215) | 5131512..5131847 | + | 336 | WP_014227760.1 | endoribonuclease SymE | - |
| OEE44_RS24220 (OEE44_24220) | 5132301..5133212 | + | 912 | WP_182094964.1 | acetamidase/formamidase family protein | - |
| OEE44_RS24225 (OEE44_24225) | 5133209..5134552 | + | 1344 | WP_004128506.1 | APC family permease | - |
| OEE44_RS24230 (OEE44_24230) | 5134673..5134975 | - | 303 | WP_014227757.1 | BrnA antitoxin family protein | Antitoxin |
| OEE44_RS24235 (OEE44_24235) | 5134962..5135249 | - | 288 | WP_064380994.1 | BrnT family toxin | Toxin |
| OEE44_RS24240 (OEE44_24240) | 5135509..5135952 | - | 444 | WP_014227755.1 | FosA family fosfomycin resistance glutathione transferase | - |
| OEE44_RS24245 (OEE44_24245) | 5135946..5136854 | - | 909 | WP_049080873.1 | LysR family transcriptional regulator | - |
| OEE44_RS24250 (OEE44_24250) | 5136942..5137724 | + | 783 | WP_025108473.1 | NAD(P)H-dependent oxidoreductase | - |
| OEE44_RS24255 (OEE44_24255) | 5137872..5138456 | + | 585 | WP_004098242.1 | TetR/AcrR family transcriptional regulator | - |
| OEE44_RS24260 (OEE44_24260) | 5138474..5139274 | + | 801 | WP_182094965.1 | winged helix-turn-helix domain-containing protein | - |
| OEE44_RS24265 (OEE44_24265) | 5139271..5139789 | + | 519 | WP_004098240.1 | FidL-like protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11162.65 Da Isoelectric Point: 7.4687
>T266351 WP_064380994.1 NZ_CP114156:c5135249-5134962 [Klebsiella michiganensis]
MPMEFEWDANKAISNLRKHGIRFEEAVLVLDDPRHLSRQDRYENGEYRWQTIGLVHGVIVIMVAHSVRFESGTEVIRIIS
ARKADSKERNRYEHG
MPMEFEWDANKAISNLRKHGIRFEEAVLVLDDPRHLSRQDRYENGEYRWQTIGLVHGVIVIMVAHSVRFESGTEVIRIIS
ARKADSKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A443WNM0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3H591 |