Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4458329..4458948 | Replicon | chromosome |
Accession | NZ_CP114156 | ||
Organism | Klebsiella michiganensis strain 2022CK-00497 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H3N9D8 |
Locus tag | OEE44_RS21120 | Protein ID | WP_004099646.1 |
Coordinates | 4458730..4458948 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A0J2I7Z1 |
Locus tag | OEE44_RS21115 | Protein ID | WP_025107145.1 |
Coordinates | 4458329..4458703 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEE44_RS21105 (OEE44_21105) | 4453485..4454678 | + | 1194 | WP_004136054.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
OEE44_RS21110 (OEE44_21110) | 4454701..4457847 | + | 3147 | WP_032748290.1 | multidrug efflux RND transporter permease subunit AcrB | - |
OEE44_RS21115 (OEE44_21115) | 4458329..4458703 | + | 375 | WP_025107145.1 | Hha toxicity modulator TomB | Antitoxin |
OEE44_RS21120 (OEE44_21120) | 4458730..4458948 | + | 219 | WP_004099646.1 | HHA domain-containing protein | Toxin |
OEE44_RS21125 (OEE44_21125) | 4459111..4459677 | + | 567 | WP_032748289.1 | maltose O-acetyltransferase | - |
OEE44_RS21130 (OEE44_21130) | 4459649..4459783 | - | 135 | WP_223226764.1 | hypothetical protein | - |
OEE44_RS21135 (OEE44_21135) | 4459804..4460274 | + | 471 | WP_014228205.1 | YlaC family protein | - |
OEE44_RS21140 (OEE44_21140) | 4460249..4461703 | - | 1455 | WP_182094349.1 | PLP-dependent aminotransferase family protein | - |
OEE44_RS21145 (OEE44_21145) | 4461805..4462503 | + | 699 | WP_048261453.1 | GNAT family protein | - |
OEE44_RS21150 (OEE44_21150) | 4462500..4462640 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
OEE44_RS21155 (OEE44_21155) | 4462640..4462903 | - | 264 | WP_004848323.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8640.05 Da Isoelectric Point: 8.9008
>T266349 WP_004099646.1 NZ_CP114156:4458730-4458948 [Klebsiella michiganensis]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14366.15 Da Isoelectric Point: 4.8989
>AT266349 WP_025107145.1 NZ_CP114156:4458329-4458703 [Klebsiella michiganensis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNACRENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNACRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3H713 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J2I7Z1 |