Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4458329..4458948 Replicon chromosome
Accession NZ_CP114156
Organism Klebsiella michiganensis strain 2022CK-00497

Toxin (Protein)


Gene name Hha Uniprot ID H3N9D8
Locus tag OEE44_RS21120 Protein ID WP_004099646.1
Coordinates 4458730..4458948 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A0J2I7Z1
Locus tag OEE44_RS21115 Protein ID WP_025107145.1
Coordinates 4458329..4458703 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OEE44_RS21105 (OEE44_21105) 4453485..4454678 + 1194 WP_004136054.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OEE44_RS21110 (OEE44_21110) 4454701..4457847 + 3147 WP_032748290.1 multidrug efflux RND transporter permease subunit AcrB -
OEE44_RS21115 (OEE44_21115) 4458329..4458703 + 375 WP_025107145.1 Hha toxicity modulator TomB Antitoxin
OEE44_RS21120 (OEE44_21120) 4458730..4458948 + 219 WP_004099646.1 HHA domain-containing protein Toxin
OEE44_RS21125 (OEE44_21125) 4459111..4459677 + 567 WP_032748289.1 maltose O-acetyltransferase -
OEE44_RS21130 (OEE44_21130) 4459649..4459783 - 135 WP_223226764.1 hypothetical protein -
OEE44_RS21135 (OEE44_21135) 4459804..4460274 + 471 WP_014228205.1 YlaC family protein -
OEE44_RS21140 (OEE44_21140) 4460249..4461703 - 1455 WP_182094349.1 PLP-dependent aminotransferase family protein -
OEE44_RS21145 (OEE44_21145) 4461805..4462503 + 699 WP_048261453.1 GNAT family protein -
OEE44_RS21150 (OEE44_21150) 4462500..4462640 - 141 WP_003859006.1 type B 50S ribosomal protein L36 -
OEE44_RS21155 (OEE44_21155) 4462640..4462903 - 264 WP_004848323.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-115)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8640.05 Da        Isoelectric Point: 8.9008

>T266349 WP_004099646.1 NZ_CP114156:4458730-4458948 [Klebsiella michiganensis]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14366.15 Da        Isoelectric Point: 4.8989

>AT266349 WP_025107145.1 NZ_CP114156:4458329-4458703 [Klebsiella michiganensis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNACRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3H713

Antitoxin

Source ID Structure
AlphaFold DB A0A0J2I7Z1

References