Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 871201..871858 | Replicon | chromosome |
| Accession | NZ_CP114156 | ||
| Organism | Klebsiella michiganensis strain 2022CK-00497 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | J5U333 |
| Locus tag | OEE44_RS04210 | Protein ID | WP_004854060.1 |
| Coordinates | 871448..871858 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | H3N295 |
| Locus tag | OEE44_RS04205 | Protein ID | WP_004124953.1 |
| Coordinates | 871201..871467 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OEE44_RS04190 (OEE44_04190) | 866435..866860 | - | 426 | WP_004854067.1 | PTS sugar transporter subunit IIA | - |
| OEE44_RS04195 (OEE44_04195) | 866981..869779 | - | 2799 | WP_049079129.1 | transcriptional regulator DagR | - |
| OEE44_RS04200 (OEE44_04200) | 869973..870956 | - | 984 | WP_014226793.1 | tRNA-modifying protein YgfZ | - |
| OEE44_RS04205 (OEE44_04205) | 871201..871467 | + | 267 | WP_004124953.1 | FAD assembly factor SdhE | Antitoxin |
| OEE44_RS04210 (OEE44_04210) | 871448..871858 | + | 411 | WP_004854060.1 | protein YgfX | Toxin |
| OEE44_RS04215 (OEE44_04215) | 871867..872388 | - | 522 | WP_143440241.1 | flavodoxin FldB | - |
| OEE44_RS04220 (OEE44_04220) | 872510..873406 | + | 897 | WP_004105555.1 | site-specific tyrosine recombinase XerD | - |
| OEE44_RS04225 (OEE44_04225) | 873429..874142 | + | 714 | WP_004854054.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| OEE44_RS04230 (OEE44_04230) | 874148..875881 | + | 1734 | WP_182095148.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16106.97 Da Isoelectric Point: 10.9455
>T266344 WP_004854060.1 NZ_CP114156:871448-871858 [Klebsiella michiganensis]
VVLWQSDLRISWRAQWFSLLMHGVVAALVLLMPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIIGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLLKPTQE
VVLWQSDLRISWRAQWFSLLMHGVVAALVLLMPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIIGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLLKPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYA5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3H3L9 |