Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 772837..773615 | Replicon | chromosome |
Accession | NZ_CP114156 | ||
Organism | Klebsiella michiganensis strain 2022CK-00497 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | OEE44_RS03715 | Protein ID | WP_182094790.1 |
Coordinates | 773127..773615 (+) | Length | 163 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | A0A2J5Q8I3 |
Locus tag | OEE44_RS03710 | Protein ID | WP_049101739.1 |
Coordinates | 772837..773130 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEE44_RS03690 (OEE44_03690) | 767993..769138 | - | 1146 | WP_085520127.1 | PLP-dependent aspartate aminotransferase family protein | - |
OEE44_RS03695 (OEE44_03695) | 769149..770519 | - | 1371 | WP_025105933.1 | cystathionine beta-synthase | - |
OEE44_RS03700 (OEE44_03700) | 770553..770795 | + | 243 | WP_014226848.1 | hypothetical protein | - |
OEE44_RS03705 (OEE44_03705) | 771065..772453 | + | 1389 | WP_048260433.1 | DASS family sodium-coupled anion symporter | - |
OEE44_RS03710 (OEE44_03710) | 772837..773130 | + | 294 | WP_049101739.1 | DUF1778 domain-containing protein | Antitoxin |
OEE44_RS03715 (OEE44_03715) | 773127..773615 | + | 489 | WP_182094790.1 | GNAT family N-acetyltransferase | Toxin |
OEE44_RS03720 (OEE44_03720) | 773680..774378 | + | 699 | WP_032692862.1 | hypothetical protein | - |
OEE44_RS03725 (OEE44_03725) | 774485..776185 | - | 1701 | WP_032692861.1 | hypothetical protein | - |
OEE44_RS03730 (OEE44_03730) | 776182..778092 | - | 1911 | WP_182094789.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 163 a.a. Molecular weight: 17731.67 Da Isoelectric Point: 7.7536
>T266343 WP_182094790.1 NZ_CP114156:773127-773615 [Klebsiella michiganensis]
MISTPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQLSGASRTFVCCHDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDRSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYLRVGFEPSPMDPMMFMVTLGDLVE
SI
MISTPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQLSGASRTFVCCHDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDRSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYLRVGFEPSPMDPMMFMVTLGDLVE
SI
Download Length: 489 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|