266341

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 5824..6349 Replicon plasmid unnamed2
Accession NZ_CP114151
Organism Klebsiella michiganensis strain 2022CK-00496

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag OEE45_RS29065 Protein ID WP_013023785.1
Coordinates 5824..6129 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag OEE45_RS29070 Protein ID WP_001568025.1
Coordinates 6131..6349 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OEE45_RS29035 (OEE45_29045) 1511..2137 + 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -
OEE45_RS29040 (OEE45_29050) 2134..2436 + 303 WP_004197636.1 hypothetical protein -
OEE45_RS29045 (OEE45_29055) 2900..3694 - 795 WP_053389905.1 site-specific integrase -
OEE45_RS29050 (OEE45_29060) 3892..4908 - 1017 WP_017899884.1 hypothetical protein -
OEE45_RS29055 (OEE45_29065) 4919..5233 - 315 WP_053389906.1 hypothetical protein -
OEE45_RS29060 (OEE45_29070) 5260..5655 - 396 WP_162269742.1 hypothetical protein -
OEE45_RS29065 (OEE45_29075) 5824..6129 - 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
OEE45_RS29070 (OEE45_29080) 6131..6349 - 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
OEE45_RS29075 (OEE45_29085) 6519..6764 - 246 Protein_9 hypothetical protein -
OEE45_RS29080 (OEE45_29090) 6914..7426 + 513 WP_117326276.1 hypothetical protein -
OEE45_RS29085 (OEE45_29095) 7460..8593 - 1134 WP_000545987.1 DUF3800 domain-containing protein -
OEE45_RS29090 (OEE45_29100) 8760..9533 - 774 WP_270038079.1 hypothetical protein -
OEE45_RS29095 (OEE45_29105) 9546..10046 - 501 WP_116967875.1 HEPN family nuclease -
OEE45_RS29100 (OEE45_29110) 10321..10584 + 264 WP_043519726.1 hypothetical protein -
OEE45_RS29105 (OEE45_29115) 10581..11147 + 567 WP_202707995.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aadA2 / qacE / sul1 - 1..131529 131529


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T266341 WP_013023785.1 NZ_CP114151:c6129-5824 [Klebsiella michiganensis]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT266341 WP_001568025.1 NZ_CP114151:c6349-6131 [Klebsiella michiganensis]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References