Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 72721..73457 | Replicon | plasmid unnamed1 |
Accession | NZ_CP114150 | ||
Organism | Klebsiella michiganensis strain 2022CK-00496 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | OEE45_RS28465 | Protein ID | WP_181479570.1 |
Coordinates | 72721..73203 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | - |
Locus tag | OEE45_RS28470 | Protein ID | WP_049083184.1 |
Coordinates | 73191..73457 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEE45_RS28445 (OEE45_28455) | 67771..68421 | - | 651 | Protein_81 | helix-turn-helix domain-containing protein | - |
OEE45_RS28450 (OEE45_28460) | 68698..69402 | - | 705 | WP_031591821.1 | toll/interleukin-1 receptor domain-containing protein | - |
OEE45_RS28455 (OEE45_28465) | 69562..70908 | - | 1347 | WP_077251107.1 | ISNCY family transposase | - |
OEE45_RS28460 (OEE45_28470) | 71031..72563 | + | 1533 | WP_009310015.1 | IS3-like element ISKpn38 family transposase | - |
OEE45_RS28465 (OEE45_28475) | 72721..73203 | - | 483 | WP_181479570.1 | GNAT family N-acetyltransferase | Toxin |
OEE45_RS28470 (OEE45_28480) | 73191..73457 | - | 267 | WP_049083184.1 | DUF1778 domain-containing protein | Antitoxin |
OEE45_RS28475 (OEE45_28485) | 73553..73876 | + | 324 | WP_115656969.1 | hypothetical protein | - |
OEE45_RS28480 (OEE45_28490) | 73929..74710 | - | 782 | Protein_88 | IS21-like element ISSen3 family helper ATPase IstB | - |
OEE45_RS28485 (OEE45_28495) | 74707..75729 | - | 1023 | WP_110184588.1 | IS21 family transposase | - |
OEE45_RS28490 (OEE45_28500) | 75819..76283 | + | 465 | WP_177957707.1 | hypothetical protein | - |
OEE45_RS28500 (OEE45_28510) | 77190..78158 | - | 969 | WP_270037960.1 | IS5 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | pla | 1..186939 | 186939 | |
- | inside | IScluster/Tn | - | - | 63548..78158 | 14610 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17354.96 Da Isoelectric Point: 9.1188
>T266340 WP_181479570.1 NZ_CP114150:c73203-72721 [Klebsiella michiganensis]
VGRITAPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVVENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
VGRITAPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVVENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|