Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 38315..38837 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP114150 | ||
| Organism | Klebsiella michiganensis strain 2022CK-00496 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | A0A9J6S4Z8 |
| Locus tag | OEE45_RS28280 | Protein ID | WP_004187019.1 |
| Coordinates | 38315..38599 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | A0A2J4ZSR4 |
| Locus tag | OEE45_RS28285 | Protein ID | WP_004187025.1 |
| Coordinates | 38589..38837 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OEE45_RS28260 (OEE45_28270) | 33338..34627 | + | 1290 | WP_115656965.1 | arsenite efflux transporter membrane subunit ArsB | - |
| OEE45_RS28265 (OEE45_28275) | 34640..35068 | + | 429 | WP_035897523.1 | glutaredoxin-dependent arsenate reductase | - |
| OEE45_RS28270 (OEE45_28280) | 35335..36867 | - | 1533 | WP_009310015.1 | IS3-like element ISKpn38 family transposase | - |
| OEE45_RS28275 (OEE45_28285) | 36956..38299 | + | 1344 | WP_040120121.1 | ISNCY family transposase | - |
| OEE45_RS28280 (OEE45_28290) | 38315..38599 | - | 285 | WP_004187019.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OEE45_RS28285 (OEE45_28295) | 38589..38837 | - | 249 | WP_004187025.1 | plasmid stabilization protein | Antitoxin |
| OEE45_RS28290 (OEE45_28300) | 39346..40314 | - | 969 | WP_014839948.1 | IS5 family transposase | - |
| OEE45_RS28295 (OEE45_28305) | 40349..40621 | + | 273 | Protein_51 | transposase domain-containing protein | - |
| OEE45_RS28300 (OEE45_28310) | 40743..42476 | - | 1734 | WP_032738458.1 | nitrilase-related carbon-nitrogen hydrolase | - |
| OEE45_RS28305 (OEE45_28315) | 42527..43168 | - | 642 | WP_032430981.1 | ANTAR domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | pla | 1..186939 | 186939 | |
| - | inside | IScluster/Tn | - | - | 27976..40621 | 12645 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11003.72 Da Isoelectric Point: 10.5388
>T266339 WP_004187019.1 NZ_CP114150:c38599-38315 [Klebsiella michiganensis]
MTYKLAFNESALKEWKKLGHTLQVQFKKKLKERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYRVEDDIVTVTVIGVGK
RENDDIYNATLNRN
MTYKLAFNESALKEWKKLGHTLQVQFKKKLKERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYRVEDDIVTVTVIGVGK
RENDDIYNATLNRN
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|