Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 5257823..5258399 | Replicon | chromosome |
Accession | NZ_CP114149 | ||
Organism | Klebsiella michiganensis strain 2022CK-00496 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | A0A1Q8YXR6 |
Locus tag | OEE45_RS24775 | Protein ID | WP_046878034.1 |
Coordinates | 5258112..5258399 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | A0A0H3H591 |
Locus tag | OEE45_RS24770 | Protein ID | WP_014227757.1 |
Coordinates | 5257823..5258125 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEE45_RS24755 (OEE45_24765) | 5254659..5254994 | + | 336 | WP_064375703.1 | endoribonuclease SymE | - |
OEE45_RS24760 (OEE45_24770) | 5255451..5256362 | + | 912 | WP_049080536.1 | acetamidase/formamidase family protein | - |
OEE45_RS24765 (OEE45_24775) | 5256359..5257702 | + | 1344 | WP_049101852.1 | APC family permease | - |
OEE45_RS24770 (OEE45_24780) | 5257823..5258125 | - | 303 | WP_014227757.1 | BrnA antitoxin family protein | Antitoxin |
OEE45_RS24775 (OEE45_24785) | 5258112..5258399 | - | 288 | WP_046878034.1 | BrnT family toxin | Toxin |
OEE45_RS24780 (OEE45_24790) | 5258554..5259522 | - | 969 | WP_016151359.1 | IS5-like element IS903B family transposase | - |
OEE45_RS24785 (OEE45_24795) | 5259717..5260160 | - | 444 | WP_014227755.1 | FosA family fosfomycin resistance glutathione transferase | - |
OEE45_RS24790 (OEE45_24800) | 5260154..5261062 | - | 909 | WP_064375700.1 | LysR family transcriptional regulator | - |
OEE45_RS24795 (OEE45_24805) | 5261150..5261932 | + | 783 | WP_064358753.1 | NAD(P)H-dependent oxidoreductase | - |
OEE45_RS24800 (OEE45_24810) | 5262080..5262664 | + | 585 | WP_004098242.1 | TetR/AcrR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | fosA | - | 5258554..5260160 | 1606 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11210.69 Da Isoelectric Point: 7.4687
>T266337 WP_046878034.1 NZ_CP114149:c5258399-5258112 [Klebsiella michiganensis]
MPMEFEWDANKAISNLRKHGIRFEEAVLVFDDPRHLSRQDRYENGEYRWQTIGLVHGIIVIMVAHSVRFESGTEVIRIIS
ARKADSKERNRYEHG
MPMEFEWDANKAISNLRKHGIRFEEAVLVFDDPRHLSRQDRYENGEYRWQTIGLVHGIIVIMVAHSVRFESGTEVIRIIS
ARKADSKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YXR6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3H591 |