Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4575619..4576238 | Replicon | chromosome |
Accession | NZ_CP114149 | ||
Organism | Klebsiella michiganensis strain 2022CK-00496 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H3N9D8 |
Locus tag | OEE45_RS21615 | Protein ID | WP_004099646.1 |
Coordinates | 4576020..4576238 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A0J2I7Z1 |
Locus tag | OEE45_RS21610 | Protein ID | WP_025107145.1 |
Coordinates | 4575619..4575993 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEE45_RS21600 (OEE45_21610) | 4570774..4571967 | + | 1194 | WP_004136054.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
OEE45_RS21605 (OEE45_21615) | 4571990..4575136 | + | 3147 | WP_270037086.1 | multidrug efflux RND transporter permease subunit AcrB | - |
OEE45_RS21610 (OEE45_21620) | 4575619..4575993 | + | 375 | WP_025107145.1 | Hha toxicity modulator TomB | Antitoxin |
OEE45_RS21615 (OEE45_21625) | 4576020..4576238 | + | 219 | WP_004099646.1 | HHA domain-containing protein | Toxin |
OEE45_RS21620 (OEE45_21630) | 4576401..4576967 | + | 567 | WP_064357999.1 | maltose O-acetyltransferase | - |
OEE45_RS21625 (OEE45_21635) | 4576939..4577073 | - | 135 | WP_224243896.1 | hypothetical protein | - |
OEE45_RS21630 (OEE45_21640) | 4577094..4577564 | + | 471 | WP_004848329.1 | YlaC family protein | - |
OEE45_RS21635 (OEE45_21645) | 4577539..4578993 | - | 1455 | Protein_4256 | PLP-dependent aminotransferase family protein | - |
OEE45_RS21640 (OEE45_21650) | 4579095..4579793 | + | 699 | WP_048261453.1 | GNAT family protein | - |
OEE45_RS21645 (OEE45_21655) | 4579790..4579930 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
OEE45_RS21650 (OEE45_21660) | 4579930..4580193 | - | 264 | WP_004848323.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8640.05 Da Isoelectric Point: 8.9008
>T266335 WP_004099646.1 NZ_CP114149:4576020-4576238 [Klebsiella michiganensis]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14366.15 Da Isoelectric Point: 4.8989
>AT266335 WP_025107145.1 NZ_CP114149:4575619-4575993 [Klebsiella michiganensis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNACRENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNACRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3H713 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J2I7Z1 |