Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4575619..4576238 Replicon chromosome
Accession NZ_CP114149
Organism Klebsiella michiganensis strain 2022CK-00496

Toxin (Protein)


Gene name Hha Uniprot ID H3N9D8
Locus tag OEE45_RS21615 Protein ID WP_004099646.1
Coordinates 4576020..4576238 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A0J2I7Z1
Locus tag OEE45_RS21610 Protein ID WP_025107145.1
Coordinates 4575619..4575993 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OEE45_RS21600 (OEE45_21610) 4570774..4571967 + 1194 WP_004136054.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OEE45_RS21605 (OEE45_21615) 4571990..4575136 + 3147 WP_270037086.1 multidrug efflux RND transporter permease subunit AcrB -
OEE45_RS21610 (OEE45_21620) 4575619..4575993 + 375 WP_025107145.1 Hha toxicity modulator TomB Antitoxin
OEE45_RS21615 (OEE45_21625) 4576020..4576238 + 219 WP_004099646.1 HHA domain-containing protein Toxin
OEE45_RS21620 (OEE45_21630) 4576401..4576967 + 567 WP_064357999.1 maltose O-acetyltransferase -
OEE45_RS21625 (OEE45_21635) 4576939..4577073 - 135 WP_224243896.1 hypothetical protein -
OEE45_RS21630 (OEE45_21640) 4577094..4577564 + 471 WP_004848329.1 YlaC family protein -
OEE45_RS21635 (OEE45_21645) 4577539..4578993 - 1455 Protein_4256 PLP-dependent aminotransferase family protein -
OEE45_RS21640 (OEE45_21650) 4579095..4579793 + 699 WP_048261453.1 GNAT family protein -
OEE45_RS21645 (OEE45_21655) 4579790..4579930 - 141 WP_003859006.1 type B 50S ribosomal protein L36 -
OEE45_RS21650 (OEE45_21660) 4579930..4580193 - 264 WP_004848323.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-115)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8640.05 Da        Isoelectric Point: 8.9008

>T266335 WP_004099646.1 NZ_CP114149:4576020-4576238 [Klebsiella michiganensis]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14366.15 Da        Isoelectric Point: 4.8989

>AT266335 WP_025107145.1 NZ_CP114149:4575619-4575993 [Klebsiella michiganensis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNACRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3H713

Antitoxin

Source ID Structure
AlphaFold DB A0A0J2I7Z1

References