Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4355659..4356185 | Replicon | chromosome |
| Accession | NZ_CP114149 | ||
| Organism | Klebsiella michiganensis strain 2022CK-00496 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | OEE45_RS20655 | Protein ID | WP_000323025.1 |
| Coordinates | 4355659..4355946 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | OEE45_RS20660 | Protein ID | WP_000534858.1 |
| Coordinates | 4355946..4356185 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OEE45_RS20630 (OEE45_20630) | 4350809..4352353 | + | 1545 | WP_014228343.1 | sugar ABC transporter ATP-binding protein | - |
| OEE45_RS20635 (OEE45_20635) | 4352371..4353426 | + | 1056 | WP_004848640.1 | ABC transporter permease | - |
| OEE45_RS20640 (OEE45_20640) | 4353487..4354284 | + | 798 | WP_014228342.1 | SDR family oxidoreductase | - |
| OEE45_RS20645 (OEE45_20645) | 4354464..4355249 | + | 786 | WP_064358087.1 | SDR family oxidoreductase | - |
| OEE45_RS20650 (OEE45_20650) | 4355444..4355596 | - | 153 | WP_004130292.1 | Hok/Gef family protein | - |
| OEE45_RS20655 (OEE45_20655) | 4355659..4355946 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| OEE45_RS20660 (OEE45_20660) | 4355946..4356185 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| OEE45_RS20665 (OEE45_20665) | 4356210..4356314 | + | 105 | Protein_4063 | protein YdfV | - |
| OEE45_RS20670 (OEE45_20670) | 4356448..4357371 | - | 924 | WP_000167917.1 | cation diffusion facilitator family transporter | - |
| OEE45_RS20675 (OEE45_20675) | 4357571..4358143 | - | 573 | WP_001515348.1 | cytochrome b/b6 domain-containing protein | - |
| OEE45_RS20680 (OEE45_20680) | 4358786..4360126 | - | 1341 | WP_000589001.1 | ISNCY family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 4360201..4361733 | 1532 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T266334 WP_000323025.1 NZ_CP114149:c4355946-4355659 [Klebsiella michiganensis]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|