Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 1988592..1989182 | Replicon | chromosome |
Accession | NZ_CP114149 | ||
Organism | Klebsiella michiganensis strain 2022CK-00496 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A1F2LYA2 |
Locus tag | OEE45_RS09490 | Protein ID | WP_008804165.1 |
Coordinates | 1988850..1989182 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | OEE45_RS09485 | Protein ID | WP_064405693.1 |
Coordinates | 1988592..1988849 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEE45_RS09475 (OEE45_09480) | 1985916..1987871 | - | 1956 | WP_064405695.1 | hypothetical protein | - |
OEE45_RS09480 (OEE45_09485) | 1988128..1988331 | + | 204 | WP_224243742.1 | helix-turn-helix domain-containing protein | - |
OEE45_RS09485 (OEE45_09490) | 1988592..1988849 | + | 258 | WP_064405693.1 | hypothetical protein | Antitoxin |
OEE45_RS09490 (OEE45_09495) | 1988850..1989182 | + | 333 | WP_008804165.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OEE45_RS09495 (OEE45_09500) | 1990007..1990783 | + | 777 | WP_073554415.1 | sigma-70 family RNA polymerase sigma factor | - |
OEE45_RS09500 (OEE45_09505) | 1990780..1991349 | + | 570 | WP_218571335.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11867.71 Da Isoelectric Point: 10.1839
>T266329 WP_008804165.1 NZ_CP114149:1988850-1989182 [Klebsiella michiganensis]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARNGKRLERIPDAVVNEVLARLDAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARNGKRLERIPDAVVNEVLARLDAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|