Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 4054301..4054968 | Replicon | chromosome |
Accession | NZ_CP114134 | ||
Organism | Xanthomonas fragariae strain YLX21 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | OZ429_RS19175 | Protein ID | WP_269123884.1 |
Coordinates | 4054552..4054968 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | OZ429_RS19170 | Protein ID | WP_269123882.1 |
Coordinates | 4054301..4054555 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OZ429_RS19145 (OZ429_19145) | 4050121..4050255 | + | 135 | WP_269123877.1 | hypothetical protein | - |
OZ429_RS19150 (OZ429_19150) | 4050312..4051445 | - | 1134 | WP_269123878.1 | hypothetical protein | - |
OZ429_RS19160 (OZ429_19160) | 4052857..4053063 | + | 207 | WP_269123880.1 | hypothetical protein | - |
OZ429_RS19165 (OZ429_19165) | 4053050..4054162 | + | 1113 | WP_269127066.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
OZ429_RS19170 (OZ429_19170) | 4054301..4054555 | + | 255 | WP_269123882.1 | Arc family DNA-binding protein | Antitoxin |
OZ429_RS19175 (OZ429_19175) | 4054552..4054968 | + | 417 | WP_269123884.1 | PIN domain-containing protein | Toxin |
OZ429_RS19180 (OZ429_19180) | 4055028..4055261 | + | 234 | WP_269123886.1 | hypothetical protein | - |
OZ429_RS19185 (OZ429_19185) | 4055266..4056018 | + | 753 | WP_269123888.1 | DUF3800 domain-containing protein | - |
OZ429_RS19190 (OZ429_19190) | 4056094..4057371 | - | 1278 | WP_269123891.1 | HipA domain-containing protein | - |
OZ429_RS19195 (OZ429_19195) | 4057368..4057568 | - | 201 | WP_269123893.1 | helix-turn-helix domain-containing protein | - |
OZ429_RS19200 (OZ429_19200) | 4057803..4057967 | - | 165 | WP_269123895.1 | hypothetical protein | - |
OZ429_RS19205 (OZ429_19205) | 4058046..4059653 | + | 1608 | WP_269123897.1 | alpha/beta hydrolase-fold protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 4049655..4050041 | 386 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14937.29 Da Isoelectric Point: 5.6142
>T266325 WP_269123884.1 NZ_CP114134:4054552-4054968 [Xanthomonas fragariae]
VILLDTNVISELWRPQPNPKVVAWIDAQAVETLFLSVVTVAELRFGIAVMPEGRKRYTLHARLESDVLPLFDGRLLAFDL
DASHAFATLASKARTAGLTLGRADAYIAATAAAHALAVATRDTAPFEAMALDVINPWI
VILLDTNVISELWRPQPNPKVVAWIDAQAVETLFLSVVTVAELRFGIAVMPEGRKRYTLHARLESDVLPLFDGRLLAFDL
DASHAFATLASKARTAGLTLGRADAYIAATAAAHALAVATRDTAPFEAMALDVINPWI
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|