Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 3043619..3044397 | Replicon | chromosome |
Accession | NZ_CP114134 | ||
Organism | Xanthomonas fragariae strain YLX21 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | OZ429_RS14305 | Protein ID | WP_269122574.1 |
Coordinates | 3043906..3044397 (+) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | G0CD67 |
Locus tag | OZ429_RS14300 | Protein ID | WP_014508712.1 |
Coordinates | 3043619..3043909 (+) | Length | 97 a.a. |
Genomic Context
Location: 3039919..3042498 (2580 bp)
Type: Others
Protein ID: WP_269122571.1
Type: Others
Protein ID: WP_269122571.1
Location: 3043139..3043543 (405 bp)
Type: Others
Protein ID: WP_269122573.1
Type: Others
Protein ID: WP_269122573.1
Location: 3043619..3043909 (291 bp)
Type: Antitoxin
Protein ID: WP_014508712.1
Type: Antitoxin
Protein ID: WP_014508712.1
Location: 3043906..3044397 (492 bp)
Type: Toxin
Protein ID: WP_269122574.1
Type: Toxin
Protein ID: WP_269122574.1
Location: 3044546..3045880 (1335 bp)
Type: Others
Protein ID: WP_269122576.1
Type: Others
Protein ID: WP_269122576.1
Location: 3046339..3047016 (678 bp)
Type: Others
Protein ID: WP_002804927.1
Type: Others
Protein ID: WP_002804927.1
Location: 3047042..3047485 (444 bp)
Type: Others
Protein ID: Protein_2684
Type: Others
Protein ID: Protein_2684
Location: 3047708..3048613 (906 bp)
Type: Others
Protein ID: WP_208589518.1
Type: Others
Protein ID: WP_208589518.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OZ429_RS14290 (OZ429_14290) | 3039919..3042498 | + | 2580 | WP_269122571.1 | RHS repeat domain-containing protein | - |
OZ429_RS14295 (OZ429_14295) | 3043139..3043543 | + | 405 | WP_269122573.1 | SymE family type I addiction module toxin | - |
OZ429_RS14300 (OZ429_14300) | 3043619..3043909 | + | 291 | WP_014508712.1 | DUF1778 domain-containing protein | Antitoxin |
OZ429_RS14305 (OZ429_14305) | 3043906..3044397 | + | 492 | WP_269122574.1 | GNAT family N-acetyltransferase | Toxin |
OZ429_RS14310 (OZ429_14310) | 3044546..3045880 | - | 1335 | WP_269122576.1 | HAMP domain-containing sensor histidine kinase | - |
OZ429_RS14315 (OZ429_14315) | 3046339..3047016 | - | 678 | WP_002804927.1 | response regulator transcription factor | - |
OZ429_RS14320 (OZ429_14320) | 3047042..3047485 | - | 444 | Protein_2684 | hypothetical protein | - |
OZ429_RS14325 (OZ429_14325) | 3047708..3048613 | - | 906 | WP_208589518.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17549.20 Da Isoelectric Point: 8.9888
>T266323 WP_269122574.1 NZ_CP114134:3043906-3044397 [Xanthomonas fragariae]
MTVSAPEPLTAHHRVEPFASGVESLDHWLKRRALKNQATGASRAFVACADDRVVAYYALASSAVAVDATPGRFRRNMPDQ
IPVVVLGRLAVDQSLHGRGFGRALVQDAGKRILHAADTIGIRGLLVHALSADAKAFYERIGFEPSPLDPMVLVVTLEDLK
ASL
MTVSAPEPLTAHHRVEPFASGVESLDHWLKRRALKNQATGASRAFVACADDRVVAYYALASSAVAVDATPGRFRRNMPDQ
IPVVVLGRLAVDQSLHGRGFGRALVQDAGKRILHAADTIGIRGLLVHALSADAKAFYERIGFEPSPLDPMVLVVTLEDLK
ASL
Download Length: 492 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3E1LB51 |