Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
| Location | 1493524..1494203 | Replicon | chromosome |
| Accession | NZ_CP114134 | ||
| Organism | Xanthomonas fragariae strain YLX21 | ||
Toxin (Protein)
| Gene name | tad | Uniprot ID | - |
| Locus tag | OZ429_RS07095 | Protein ID | WP_269125924.1 |
| Coordinates | 1493524..1493886 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | ata | Uniprot ID | - |
| Locus tag | OZ429_RS07100 | Protein ID | WP_208590306.1 |
| Coordinates | 1493886..1494203 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OZ429_RS07075 (OZ429_07075) | 1489424..1490229 | + | 806 | WP_269121653.1 | IS5 family transposase | - |
| OZ429_RS07080 (OZ429_07080) | 1490415..1490693 | - | 279 | Protein_1329 | NAD(P)H-dependent oxidoreductase | - |
| OZ429_RS07085 (OZ429_07085) | 1490796..1491809 | + | 1014 | WP_269125920.1 | LysR family transcriptional regulator | - |
| OZ429_RS07095 (OZ429_07095) | 1493524..1493886 | + | 363 | WP_269125924.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OZ429_RS07100 (OZ429_07100) | 1493886..1494203 | + | 318 | WP_208590306.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| OZ429_RS07105 (OZ429_07105) | 1494249..1495733 | - | 1485 | WP_269125927.1 | site-specific integrase | - |
| OZ429_RS07115 (OZ429_07115) | 1496306..1497256 | - | 951 | WP_269125929.1 | IS481 family transposase | - |
| OZ429_RS07120 (OZ429_07120) | 1497438..1498217 | + | 780 | WP_269125931.1 | hypothetical protein | - |
| OZ429_RS07125 (OZ429_07125) | 1498374..1498934 | + | 561 | WP_269125933.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1489843..1518941 | 29098 | |
| - | inside | IScluster/Tn | - | - | 1489843..1500129 | 10286 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13491.36 Da Isoelectric Point: 7.1653
>T266322 WP_269125924.1 NZ_CP114134:1493524-1493886 [Xanthomonas fragariae]
MPEKPLIWVGSSRRDLAELPEDVKDTFGFALSEAQNGRTHVRAKPMAKGSLKGKGIYEVVDDYDGDTFRAVYTVEIEDAI
YALHCFQKKSKNGRETPKSDIDLIESRYQAALLDAKKVKI
MPEKPLIWVGSSRRDLAELPEDVKDTFGFALSEAQNGRTHVRAKPMAKGSLKGKGIYEVVDDYDGDTFRAVYTVEIEDAI
YALHCFQKKSKNGRETPKSDIDLIESRYQAALLDAKKVKI
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|