Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | pmenTA/darT(toxin) |
Location | 779705..781374 | Replicon | chromosome |
Accession | NZ_CP114134 | ||
Organism | Xanthomonas fragariae strain YLX21 |
Toxin (Protein)
Gene name | pmenT | Uniprot ID | - |
Locus tag | OZ429_RS03670 | Protein ID | WP_269126796.1 |
Coordinates | 780775..781374 (-) | Length | 200 a.a. |
Antitoxin (Protein)
Gene name | pmenA | Uniprot ID | - |
Locus tag | OZ429_RS03665 | Protein ID | WP_269124963.1 |
Coordinates | 779705..780775 (-) | Length | 357 a.a. |
Genomic Context
Location: 774836..775945 (1110 bp)
Type: Others
Protein ID: WP_269124953.1
Type: Others
Protein ID: WP_269124953.1
Location: 776130..776960 (831 bp)
Type: Others
Protein ID: WP_269124955.1
Type: Others
Protein ID: WP_269124955.1
Location: 777967..778782 (816 bp)
Type: Others
Protein ID: WP_269124959.1
Type: Others
Protein ID: WP_269124959.1
Location: 779038..779598 (561 bp)
Type: Others
Protein ID: WP_269124961.1
Type: Others
Protein ID: WP_269124961.1
Location: 782717..783508 (792 bp)
Type: Others
Protein ID: WP_269124968.1
Type: Others
Protein ID: WP_269124968.1
Location: 783764..784441 (678 bp)
Type: Others
Protein ID: Protein_691
Type: Others
Protein ID: Protein_691
Location: 784550..785847 (1298 bp)
Type: Others
Protein ID: Protein_692
Type: Others
Protein ID: Protein_692
Location: 777059..777397 (339 bp)
Type: Others
Protein ID: WP_269124957.1
Type: Others
Protein ID: WP_269124957.1
Location: 777463..777702 (240 bp)
Type: Others
Protein ID: Protein_684
Type: Others
Protein ID: Protein_684
Location: 779705..780775 (1071 bp)
Type: Antitoxin
Protein ID: WP_269124963.1
Type: Antitoxin
Protein ID: WP_269124963.1
Location: 780775..781374 (600 bp)
Type: Toxin
Protein ID: WP_269126796.1
Type: Toxin
Protein ID: WP_269126796.1
Location: 781745..782671 (927 bp)
Type: Others
Protein ID: WP_269124965.1
Type: Others
Protein ID: WP_269124965.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OZ429_RS03635 (OZ429_03635) | 774836..775945 | + | 1110 | WP_269124953.1 | S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase | - |
OZ429_RS03640 (OZ429_03640) | 776130..776960 | + | 831 | WP_269124955.1 | S-formylglutathione hydrolase | - |
OZ429_RS03645 (OZ429_03645) | 777059..777397 | - | 339 | WP_269124957.1 | hypothetical protein | - |
OZ429_RS03650 (OZ429_03650) | 777463..777702 | - | 240 | Protein_684 | DegV family protein | - |
OZ429_RS03655 (OZ429_03655) | 777967..778782 | + | 816 | WP_269124959.1 | cellulase | - |
OZ429_RS03660 (OZ429_03660) | 779038..779598 | + | 561 | WP_269124961.1 | DUF924 family protein | - |
OZ429_RS03665 (OZ429_03665) | 779705..780775 | - | 1071 | WP_269124963.1 | macro domain-containing protein | Antitoxin |
OZ429_RS03670 (OZ429_03670) | 780775..781374 | - | 600 | WP_269126796.1 | DUF4433 domain-containing protein | Toxin |
OZ429_RS03675 (OZ429_03675) | 781745..782671 | - | 927 | WP_269124965.1 | Grx4 family monothiol glutaredoxin | - |
OZ429_RS03680 (OZ429_03680) | 782717..783508 | + | 792 | WP_269124968.1 | polysaccharide deacetylase family protein | - |
OZ429_RS03685 (OZ429_03685) | 783764..784441 | + | 678 | Protein_691 | IS30 family transposase | - |
OZ429_RS03690 (OZ429_03690) | 784550..785847 | + | 1298 | Protein_692 | IS701 family transposase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 200 a.a. Molecular weight: 22716.86 Da Isoelectric Point: 7.2063
>T266321 WP_269126796.1 NZ_CP114134:c781374-780775 [Xanthomonas fragariae]
IVHRDNLPWIMDNGLHCANGGVQSPGWVSIGNPELIAKRANHPVSLAPGGFLNDYVPFYFTPFSPMLRNIHTGWGGIQQR
SNEEIVILVSSLRQVAARGWPFLFTDGHAYSQLTTFHSDLAKLDKIDWPLLQARDFRRDQEDPAKFERYQAEALVHRHLP
VDGLCGIVCYTDDLKLSIERQLKARNLTLPVHARTEWYF
IVHRDNLPWIMDNGLHCANGGVQSPGWVSIGNPELIAKRANHPVSLAPGGFLNDYVPFYFTPFSPMLRNIHTGWGGIQQR
SNEEIVILVSSLRQVAARGWPFLFTDGHAYSQLTTFHSDLAKLDKIDWPLLQARDFRRDQEDPAKFERYQAEALVHRHLP
VDGLCGIVCYTDDLKLSIERQLKARNLTLPVHARTEWYF
Download Length: 600 bp
Antitoxin
Download Length: 357 a.a. Molecular weight: 39622.65 Da Isoelectric Point: 5.8202
>AT266321 WP_269124963.1 NZ_CP114134:c780775-779705 [Xanthomonas fragariae]
MIMFTQGNLLQARVEALVNTVNTVGVMGKGIALMFKERFNENFLRYAAACKAKQVRTGKVFVTEANELDGPRWIINFPTK
QHWRGDSRIEWITEGLQDLRLFLIENKVGSIAIPPLGAGNGGLDWADVRPLIEEALAGLDTDILVFEPTVKYQNVAKRSG
VEKLTPARALIAELIRRYWVLGVECSLLEIQKLAWFLERNIERAGLPTLDLRFAPHKYGPYADRLRHLLDGLDGSYLHCD
KRIGDADPIDVIWFDDARKSVVQAYLKSEAKQYAPALEATAALIDGFETPFGMELLATVDWLIAQGGVCPQVADMREGIR
NWPGGADAAVRKDRLFDDRALGIALERLTSSASAVT
MIMFTQGNLLQARVEALVNTVNTVGVMGKGIALMFKERFNENFLRYAAACKAKQVRTGKVFVTEANELDGPRWIINFPTK
QHWRGDSRIEWITEGLQDLRLFLIENKVGSIAIPPLGAGNGGLDWADVRPLIEEALAGLDTDILVFEPTVKYQNVAKRSG
VEKLTPARALIAELIRRYWVLGVECSLLEIQKLAWFLERNIERAGLPTLDLRFAPHKYGPYADRLRHLLDGLDGSYLHCD
KRIGDADPIDVIWFDDARKSVVQAYLKSEAKQYAPALEATAALIDGFETPFGMELLATVDWLIAQGGVCPQVADMREGIR
NWPGGADAAVRKDRLFDDRALGIALERLTSSASAVT
Download Length: 1071 bp