Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 88244..88803 Replicon plasmid pNJS001-3
Accession NZ_CP114133
Organism Escherichia coli strain NJS001

Toxin (Protein)


Gene name relE Uniprot ID O82928
Locus tag N0F11_RS28970 Protein ID WP_000421248.1
Coordinates 88244..88519 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID C1J8K5
Locus tag N0F11_RS28975 Protein ID WP_001178089.1
Coordinates 88519..88803 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N0F11_RS28935 (83597) 83597..83986 - 390 WP_001172748.1 cytochrome b562 -
N0F11_RS28940 (84030) 84030..86240 - 2211 WP_000592771.1 catalase/peroxidase KatP -
N0F11_RS28945 (86417) 86417..86602 + 186 WP_001302179.1 hypothetical protein -
N0F11_RS28950 (86602) 86602..87018 + 417 Protein_87 IS91 family transposase -
N0F11_RS28955 (87018) 87018..87584 + 567 Protein_88 IS3-like element IS600 family transposase -
N0F11_RS28960 (87628) 87628..87843 + 216 Protein_89 transposase -
N0F11_RS28965 (87943) 87943..88149 - 207 WP_001105064.1 hypothetical protein -
N0F11_RS28970 (88244) 88244..88519 - 276 WP_000421248.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N0F11_RS28975 (88519) 88519..88803 - 285 WP_001178089.1 ribbon-helix-helix domain-containing protein Antitoxin
N0F11_RS28980 (89714) 89714..90571 - 858 WP_000130945.1 incFII family plasmid replication initiator RepA -
N0F11_RS28985 (90564) 90564..90638 - 75 WP_001370046.1 RepA leader peptide Tap -
N0F11_RS28990 (90874) 90874..91128 - 255 WP_000083831.1 replication regulatory protein RepA -
N0F11_RS28995 (91368) 91368..91706 - 339 WP_000766796.1 hypothetical protein -
N0F11_RS29000 (91744) 91744..91953 - 210 WP_001302200.1 hemolysin expression modulator Hha -
N0F11_RS29005 (91999) 91999..92460 - 462 WP_001233853.1 thermonuclease family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - toxB / toxB / hlyD / hlyB / hlyA / hlyC / exeG / exeE / stcE / espP / espP 1..92752 92752


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10735.42 Da        Isoelectric Point: 9.9324

>T266320 WP_000421248.1 NZ_CP114133:c88519-88244 [Escherichia coli]
MELKWSSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10474.89 Da        Isoelectric Point: 5.6558

>AT266320 WP_001178089.1 NZ_CP114133:c88803-88519 [Escherichia coli]
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
ADSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z6FAZ0

Antitoxin

Source ID Structure
AlphaFold DB A0A731IHA8

References