Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 38759..39284 | Replicon | plasmid pNJS001-3 |
Accession | NZ_CP114133 | ||
Organism | Escherichia coli strain NJS001 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | N0F11_RS28730 | Protein ID | WP_001159868.1 |
Coordinates | 38759..39064 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | N0F11_RS28735 | Protein ID | WP_000813634.1 |
Coordinates | 39066..39284 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0F11_RS28710 (33964) | 33964..35130 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
N0F11_RS28715 (35718) | 35718..35978 | - | 261 | WP_071526583.1 | RepB family plasmid replication initiator protein | - |
N0F11_RS28720 (36016) | 36016..37229 | + | 1214 | WP_162829202.1 | IS3-like element IS1203 family transposase | - |
N0F11_RS28725 (37952) | 37952..38758 | - | 807 | WP_000016989.1 | site-specific integrase | - |
N0F11_RS28730 (38759) | 38759..39064 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
N0F11_RS28735 (39066) | 39066..39284 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
N0F11_RS28740 (39743) | 39743..40426 | + | 684 | WP_010891291.1 | DNA-binding protein | - |
N0F11_RS28745 (40423) | 40423..41043 | + | 621 | WP_001248529.1 | hypothetical protein | - |
N0F11_RS28750 (41040) | 41040..41240 | + | 201 | WP_000708307.1 | hypothetical protein | - |
N0F11_RS28755 (41648) | 41648..42625 | + | 978 | WP_000361615.1 | RepB family plasmid replication initiator protein | - |
N0F11_RS28760 (42910) | 42910..43650 | - | 741 | WP_064562143.1 | tyrosine-type recombinase/integrase | - |
N0F11_RS28765 (43771) | 43771..44001 | - | 231 | WP_010891288.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | toxB / toxB / hlyD / hlyB / hlyA / hlyC / exeG / exeE / stcE / espP / espP | 1..92752 | 92752 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T266319 WP_001159868.1 NZ_CP114133:c39064-38759 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|