Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 106125..106726 Replicon plasmid pNJS001-1
Accession NZ_CP114131
Organism Escherichia coli strain NJS001

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag N0F11_RS25910 Protein ID WP_259897169.1
Coordinates 106125..106505 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag N0F11_RS25915 Protein ID WP_001190712.1
Coordinates 106505..106726 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N0F11_RS25880 (N0F11_25880) 101223..101342 - 120 WP_001376634.1 ash family protein -
N0F11_RS25885 (N0F11_25885) 101565..103049 - 1485 WP_000124150.1 terminase -
N0F11_RS25890 (N0F11_25890) 103049..104243 - 1195 Protein_123 terminase -
N0F11_RS25895 (N0F11_25895) 104329..104781 - 453 WP_001326849.1 late promoter-activating protein -
N0F11_RS25900 (N0F11_25900) 104870..105913 - 1044 WP_032192894.1 DUF968 domain-containing protein -
N0F11_RS25905 (N0F11_25905) 105941..106120 - 180 WP_000113018.1 hypothetical protein -
N0F11_RS25910 (N0F11_25910) 106125..106505 - 381 WP_259897169.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
N0F11_RS25915 (N0F11_25915) 106505..106726 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N0F11_RS25920 (N0F11_25920) 106799..107188 - 390 WP_000506726.1 S24 family peptidase -
N0F11_RS25925 (N0F11_25925) 107312..107563 - 252 WP_032153798.1 DNA polymerase III subunit theta -
N0F11_RS25930 (N0F11_25930) 107878..108135 - 258 WP_176225827.1 hypothetical protein -
N0F11_RS25935 (N0F11_25935) 108408..108983 - 576 WP_269134762.1 hypothetical protein -
N0F11_RS25940 (N0F11_25940) 109032..109406 - 375 WP_000988655.1 hypothetical protein -
N0F11_RS25945 (N0F11_25945) 109413..109706 - 294 WP_176225830.1 hypothetical protein -
N0F11_RS25950 (N0F11_25950) 109885..110118 - 234 WP_000517421.1 hypothetical protein -
N0F11_RS25955 (N0F11_25955) 110204..110464 - 261 WP_063074809.1 hypothetical protein -
N0F11_RS25960 (N0F11_25960) 110461..111372 - 912 WP_250844976.1 DUF551 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - cnf1 1..116902 116902


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(4-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13489.16 Da        Isoelectric Point: 4.8616

>T266318 WP_259897169.1 NZ_CP114131:c106505-106125 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGGAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT266318 WP_001190712.1 NZ_CP114131:c106726-106505 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References