Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 106125..106726 | Replicon | plasmid pNJS001-1 |
| Accession | NZ_CP114131 | ||
| Organism | Escherichia coli strain NJS001 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | N0F11_RS25910 | Protein ID | WP_259897169.1 |
| Coordinates | 106125..106505 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | N0F11_RS25915 | Protein ID | WP_001190712.1 |
| Coordinates | 106505..106726 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0F11_RS25880 (N0F11_25880) | 101223..101342 | - | 120 | WP_001376634.1 | ash family protein | - |
| N0F11_RS25885 (N0F11_25885) | 101565..103049 | - | 1485 | WP_000124150.1 | terminase | - |
| N0F11_RS25890 (N0F11_25890) | 103049..104243 | - | 1195 | Protein_123 | terminase | - |
| N0F11_RS25895 (N0F11_25895) | 104329..104781 | - | 453 | WP_001326849.1 | late promoter-activating protein | - |
| N0F11_RS25900 (N0F11_25900) | 104870..105913 | - | 1044 | WP_032192894.1 | DUF968 domain-containing protein | - |
| N0F11_RS25905 (N0F11_25905) | 105941..106120 | - | 180 | WP_000113018.1 | hypothetical protein | - |
| N0F11_RS25910 (N0F11_25910) | 106125..106505 | - | 381 | WP_259897169.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| N0F11_RS25915 (N0F11_25915) | 106505..106726 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| N0F11_RS25920 (N0F11_25920) | 106799..107188 | - | 390 | WP_000506726.1 | S24 family peptidase | - |
| N0F11_RS25925 (N0F11_25925) | 107312..107563 | - | 252 | WP_032153798.1 | DNA polymerase III subunit theta | - |
| N0F11_RS25930 (N0F11_25930) | 107878..108135 | - | 258 | WP_176225827.1 | hypothetical protein | - |
| N0F11_RS25935 (N0F11_25935) | 108408..108983 | - | 576 | WP_269134762.1 | hypothetical protein | - |
| N0F11_RS25940 (N0F11_25940) | 109032..109406 | - | 375 | WP_000988655.1 | hypothetical protein | - |
| N0F11_RS25945 (N0F11_25945) | 109413..109706 | - | 294 | WP_176225830.1 | hypothetical protein | - |
| N0F11_RS25950 (N0F11_25950) | 109885..110118 | - | 234 | WP_000517421.1 | hypothetical protein | - |
| N0F11_RS25955 (N0F11_25955) | 110204..110464 | - | 261 | WP_063074809.1 | hypothetical protein | - |
| N0F11_RS25960 (N0F11_25960) | 110461..111372 | - | 912 | WP_250844976.1 | DUF551 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | cnf1 | 1..116902 | 116902 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13489.16 Da Isoelectric Point: 4.8616
>T266318 WP_259897169.1 NZ_CP114131:c106505-106125 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGGAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANISRYGGLPGMSDPGGAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|