Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 4499973..4500568 | Replicon | chromosome |
| Accession | NZ_CP114130 | ||
| Organism | Escherichia coli strain NJS001 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | U9Y4M4 |
| Locus tag | N0F11_RS22380 | Protein ID | WP_000239579.1 |
| Coordinates | 4499973..4500323 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | Q8XCF3 |
| Locus tag | N0F11_RS22385 | Protein ID | WP_001223210.1 |
| Coordinates | 4500317..4500568 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0F11_RS22360 (4495419) | 4495419..4496441 | - | 1023 | WP_001301928.1 | ABC transporter permease | - |
| N0F11_RS22365 (4496455) | 4496455..4497957 | - | 1503 | WP_000205806.1 | sugar ABC transporter ATP-binding protein | - |
| N0F11_RS22370 (4498097) | 4498097..4499053 | - | 957 | WP_000265942.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| N0F11_RS22375 (4499363) | 4499363..4499893 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
| N0F11_RS22380 (4499973) | 4499973..4500323 | - | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
| N0F11_RS22385 (4500317) | 4500317..4500568 | - | 252 | WP_001223210.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
| N0F11_RS22390 (4500780) | 4500780..4501121 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
| N0F11_RS22395 (4501124) | 4501124..4504903 | - | 3780 | WP_000060930.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T266315 WP_000239579.1 NZ_CP114130:c4500323-4499973 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|