Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3727558..3728176 | Replicon | chromosome |
Accession | NZ_CP114130 | ||
Organism | Escherichia coli strain NJS001 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | N0F11_RS18805 | Protein ID | WP_001291435.1 |
Coordinates | 3727958..3728176 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | N0F11_RS18800 | Protein ID | WP_000344800.1 |
Coordinates | 3727558..3727932 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0F11_RS18790 (3722647) | 3722647..3723840 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
N0F11_RS18795 (3723863) | 3723863..3727012 | + | 3150 | WP_001132452.1 | efflux RND transporter permease AcrB | - |
N0F11_RS18800 (3727558) | 3727558..3727932 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
N0F11_RS18805 (3727958) | 3727958..3728176 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
N0F11_RS18810 (3728348) | 3728348..3728899 | + | 552 | WP_000102553.1 | maltose O-acetyltransferase | - |
N0F11_RS18815 (3729015) | 3729015..3729485 | + | 471 | WP_000136192.1 | YlaC family protein | - |
N0F11_RS18820 (3729649) | 3729649..3731199 | + | 1551 | WP_001301851.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
N0F11_RS18825 (3731241) | 3731241..3731594 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
N0F11_RS18835 (3731973) | 3731973..3732284 | + | 312 | WP_000409911.1 | MGMT family protein | - |
N0F11_RS18840 (3732317) | 3732317..3732889 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T266309 WP_001291435.1 NZ_CP114130:3727958-3728176 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT266309 WP_000344800.1 NZ_CP114130:3727558-3727932 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |