Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3272953..3273658 | Replicon | chromosome |
Accession | NZ_CP114130 | ||
Organism | Escherichia coli strain NJS001 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q8X3N0 |
Locus tag | N0F11_RS16715 | Protein ID | WP_000539519.1 |
Coordinates | 3272953..3273339 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | N0F11_RS16720 | Protein ID | WP_001280945.1 |
Coordinates | 3273329..3273658 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0F11_RS16695 (3268957) | 3268957..3269583 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
N0F11_RS16700 (3269580) | 3269580..3270695 | - | 1116 | WP_000554959.1 | aldose sugar dehydrogenase YliI | - |
N0F11_RS16705 (3270806) | 3270806..3271189 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
N0F11_RS16710 (3271402) | 3271402..3272727 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
N0F11_RS16715 (3272953) | 3272953..3273339 | + | 387 | WP_000539519.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N0F11_RS16720 (3273329) | 3273329..3273658 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
N0F11_RS16725 (3273728) | 3273728..3275056 | - | 1329 | WP_000086905.1 | GGDEF domain-containing protein | - |
N0F11_RS16730 (3275064) | 3275064..3277412 | - | 2349 | WP_000950320.1 | EAL domain-containing protein | - |
N0F11_RS16735 (3277590) | 3277590..3278501 | - | 912 | WP_001236044.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14279.42 Da Isoelectric Point: 9.9296
>T266308 WP_000539519.1 NZ_CP114130:3272953-3273339 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGSKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGSKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|