Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) paaR-paaA-parE/-
Location 3106800..3107278 Replicon chromosome
Accession NZ_CP114130
Organism Escherichia coli strain NJS001

Toxin (Protein)


Gene name parE_1 Uniprot ID A0A891SFN9
Locus tag N0F11_RS15960 Protein ID WP_001303876.1
Coordinates 3106991..3107278 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name paaA Uniprot ID Q8XD67
Locus tag N0F11_RS15955 Protein ID WP_000536233.1
Coordinates 3106800..3106991 (+) Length 64 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N0F11_RS15920 (3102204) 3102204..3102974 - 771 WP_000450992.1 DUF1627 domain-containing protein -
N0F11_RS15925 (3102996) 3102996..3103742 - 747 WP_000788751.1 ATP-binding protein -
N0F11_RS15930 (3103749) 3103749..3104840 - 1092 WP_001205823.1 hypothetical protein -
N0F11_RS15935 (3104919) 3104919..3105374 + 456 WP_000273724.1 hypothetical protein -
N0F11_RS15940 (3105581) 3105581..3106006 - 426 WP_000693855.1 toxin YdaT family protein -
N0F11_RS15945 (3105990) 3105990..3106262 - 273 WP_000887453.1 YdaS family helix-turn-helix protein -
N0F11_RS15950 (3106371) 3106371..3106772 + 402 WP_000986592.1 helix-turn-helix domain-containing protein -
N0F11_RS15955 (3106800) 3106800..3106991 + 192 WP_000536233.1 hypothetical protein Antitoxin
N0F11_RS15960 (3106991) 3106991..3107278 + 288 WP_001303876.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N0F11_RS15965 (3107556) 3107556..3107711 + 156 WP_000379575.1 DUF1391 family protein -
N0F11_RS15970 (3107713) 3107713..3107841 + 129 WP_000344963.1 protein YdfB -
N0F11_RS15975 (3107853) 3107853..3108242 + 390 WP_000394511.1 hypothetical protein -
N0F11_RS15980 (3108429) 3108429..3108614 - 186 WP_001133046.1 hypothetical protein -
N0F11_RS15985 (3109188) 3109188..3109376 + 189 WP_000413705.1 cell division inhibition protein DicB -
N0F11_RS15990 (3109373) 3109373..3109564 + 192 WP_001098307.1 DUF1482 family protein -
N0F11_RS15995 (3109658) 3109658..3112129 + 2472 WP_000034474.1 exonuclease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10978.84 Da        Isoelectric Point: 10.1360

>T266307 WP_001303876.1 NZ_CP114130:3106991-3107278 [Escherichia coli]
MLPILWLPSARDDLRQIITYIAKENPPAARRLKIRIETSVLPLSEHPYLYPPSERVSGLREIVTHPNYIILYRVAASSIE
IVSVTHSRRQFPFSI

Download         Length: 288 bp

Antitoxin


Download         Length: 64 a.a.        Molecular weight: 7025.80 Da        Isoelectric Point: 4.0270

>AT266307 WP_000536233.1 NZ_CP114130:3106800-3106991 [Escherichia coli]
MGTALSPIVSEFETTEQENSYNEWLRTKVTSSLADTRPAIPHDEVMAEMENLIAQIAVTNKSE

Download         Length: 192 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References