Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2311535..2312173 | Replicon | chromosome |
Accession | NZ_CP114130 | ||
Organism | Escherichia coli strain NJS001 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | N0F11_RS11495 | Protein ID | WP_000813794.1 |
Coordinates | 2311535..2311711 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N0F11_RS11500 | Protein ID | WP_001270286.1 |
Coordinates | 2311757..2312173 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0F11_RS11475 (2307157) | 2307157..2308329 | - | 1173 | WP_250844899.1 | BenE family transporter YdcO | - |
N0F11_RS11480 (2308421) | 2308421..2308957 | + | 537 | WP_000429145.1 | DNA-binding transcriptional regulator SutR | - |
N0F11_RS11485 (2309030) | 2309030..2310991 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
N0F11_RS11490 (2311083) | 2311083..2311313 | - | 231 | WP_000494244.1 | YncJ family protein | - |
N0F11_RS11495 (2311535) | 2311535..2311711 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
N0F11_RS11500 (2311757) | 2311757..2312173 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
N0F11_RS11505 (2312252) | 2312252..2313658 | + | 1407 | WP_000760654.1 | PLP-dependent aminotransferase family protein | - |
N0F11_RS11510 (2313903) | 2313903..2315048 | + | 1146 | WP_000047432.1 | ABC transporter substrate-binding protein | - |
N0F11_RS11515 (2315066) | 2315066..2316079 | + | 1014 | WP_000220402.1 | ABC transporter ATP-binding protein | - |
N0F11_RS11520 (2316080) | 2316080..2317021 | + | 942 | WP_001251315.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T266302 WP_000813794.1 NZ_CP114130:2311535-2311711 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT266302 WP_001270286.1 NZ_CP114130:2311757-2312173 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|