Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 890651..891305 | Replicon | chromosome |
Accession | NZ_CP114130 | ||
Organism | Escherichia coli strain NJS001 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | N0F11_RS04445 | Protein ID | WP_000244781.1 |
Coordinates | 890898..891305 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | N0F11_RS04440 | Protein ID | WP_000354046.1 |
Coordinates | 890651..890917 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0F11_RS04420 (886739) | 886739..888172 | - | 1434 | WP_001310226.1 | 6-phospho-beta-glucosidase BglA | - |
N0F11_RS04425 (888217) | 888217..888528 | + | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
N0F11_RS04430 (888692) | 888692..889351 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
N0F11_RS04435 (889428) | 889428..890408 | - | 981 | WP_000886053.1 | tRNA-modifying protein YgfZ | - |
N0F11_RS04440 (890651) | 890651..890917 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
N0F11_RS04445 (890898) | 890898..891305 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
N0F11_RS04450 (891345) | 891345..891866 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
N0F11_RS04455 (891978) | 891978..892874 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
N0F11_RS04460 (892899) | 892899..893609 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
N0F11_RS04465 (893615) | 893615..895348 | + | 1734 | WP_000813185.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T266292 WP_000244781.1 NZ_CP114130:890898-891305 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|