Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 401236..401990 | Replicon | chromosome |
Accession | NZ_CP114130 | ||
Organism | Escherichia coli strain NJS001 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | N0F11_RS01920 | Protein ID | WP_001301452.1 |
Coordinates | 401236..401721 (-) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | Q8X700 |
Locus tag | N0F11_RS01925 | Protein ID | WP_000801912.1 |
Coordinates | 401712..401990 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0F11_RS01900 (396402) | 396402..397160 | + | 759 | WP_001302007.1 | DeoR/GlpR family transcriptional regulator | - |
N0F11_RS01905 (397142) | 397142..398740 | - | 1599 | WP_001232889.1 | DNA-binding transcriptional regulator RtcR | - |
N0F11_RS01910 (398928) | 398928..400154 | + | 1227 | WP_001105473.1 | RNA-splicing ligase RtcB | - |
N0F11_RS01915 (400158) | 400158..401186 | + | 1029 | WP_000827117.1 | RNA 3'-terminal phosphate cyclase | - |
N0F11_RS01920 (401236) | 401236..401721 | - | 486 | WP_001301452.1 | GNAT family N-acetyltransferase | Toxin |
N0F11_RS01925 (401712) | 401712..401990 | - | 279 | WP_000801912.1 | DUF1778 domain-containing protein | Antitoxin |
N0F11_RS01930 (402057) | 402057..404762 | - | 2706 | WP_000906970.1 | HTH-type transcriptional regulator MalT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17650.57 Da Isoelectric Point: 9.4066
>T266289 WP_001301452.1 NZ_CP114130:c401721-401236 [Escherichia coli]
MGITAPTPLTSEHNLADFCCSDHGMNEWLKKKALKNHSSGLSRVYVICIANTRQVIGYYCLSTGSIQRNLAPGAMRRNAP
ESLPVVVLGRLAIDQAWAGKGLGVALLKDAVYRTMSIAQQVGVRALIVHALDDSVRNFYLKYAFVPSPFQSLTLLYPITL
E
MGITAPTPLTSEHNLADFCCSDHGMNEWLKKKALKNHSSGLSRVYVICIANTRQVIGYYCLSTGSIQRNLAPGAMRRNAP
ESLPVVVLGRLAIDQAWAGKGLGVALLKDAVYRTMSIAQQVGVRALIVHALDDSVRNFYLKYAFVPSPFQSLTLLYPITL
E
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|