Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 352306..353106 | Replicon | chromosome |
| Accession | NZ_CP114130 | ||
| Organism | Escherichia coli strain NJS001 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | A0A891SNC1 |
| Locus tag | N0F11_RS01710 | Protein ID | WP_000342448.1 |
| Coordinates | 352579..353106 (+) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | F4NNI1 |
| Locus tag | N0F11_RS01705 | Protein ID | WP_001277108.1 |
| Coordinates | 352306..352572 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0F11_RS01685 (347963) | 347963..348631 | + | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
| N0F11_RS01690 (348624) | 348624..349682 | + | 1059 | WP_001042003.1 | permease-like cell division protein FtsX | - |
| N0F11_RS01695 (349927) | 349927..350781 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
| N0F11_RS01700 (351052) | 351052..352155 | + | 1104 | WP_001021996.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| N0F11_RS01705 (352306) | 352306..352572 | + | 267 | WP_001277108.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| N0F11_RS01710 (352579) | 352579..353106 | + | 528 | WP_000342448.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| N0F11_RS01715 (353103) | 353103..353486 | - | 384 | WP_000778769.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| N0F11_RS01720 (353910) | 353910..355019 | + | 1110 | WP_001301528.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| N0F11_RS01725 (355067) | 355067..355993 | + | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| N0F11_RS01730 (355990) | 355990..357267 | + | 1278 | WP_000803797.1 | branched chain amino acid ABC transporter permease LivM | - |
| N0F11_RS01735 (357264) | 357264..358031 | + | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19692.68 Da Isoelectric Point: 7.3232
>T266288 WP_000342448.1 NZ_CP114130:352579-353106 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYKSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYKSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|